hCD244 Recombinant Protein

Name: hCD244 Recombinant Protein; Research Grade; MyBioSource
Brand: MyBioSource
SKU: MBS666941
Price: 605 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS666941

CD244 (2B4, SLAMF4) is a 66 kD member of the CD2/SLAM related receptor family (SRR). It is expressed on NK (3), Tcell subsets, monocytes and eosinophils(4). It is expressed at high levels on Leuikemia initiating cells, and plays a role in their proliferative… More details

$605 / 0.025 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

hCD244, Recombinant Protein

Full Product Name

Recombinant hCD244 (2B4)-muCD8 Purified (Preservative-free)

Product Gene Name

hCD244 recombinant protein

Product Synonym Names

CD244 (2B4)-muIg Purified (Preservative-free); 2B4; SLAMF4

Transfectant Cell Line

CHO

Molecular Structure

A soluble molecule consisting of murine CD8 alpha signal peptide residual amino acids and linker: (1)kpqapegkgc(10)
the mature extracellular domain of human CD244 (199aa):
(11)qgsadhvvsisgvplqlqpnsiqtkvdsiawkkllpsqngfhhilkwengslpsntsndrfsfivknlsllikaaqqqdsglyclevtsisgkvqtatfqvfvfdkvekprlqgqgkildrgrcqvalsclvsrdgnvsyawyrgskliqtagnltyldeevdingthtytcnvsnpvsweshtlnltqdcqnahqefr(209) murine IgG2a Fc + hinge regions: (233aa) prgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk (442aa total).
The molecule has a predicted monomeric non glycosylated molecular weight of 49.5 kd.. The molecule is dimeric. In SDS-PAGE, it runs at apporoximately 135 kD native, and 70 kD reduced.. CD244-muIg binds to recombinant CD48 in EIA and cell surface CD48 on Raji cell surface in FACS. This binding is blocked by anti-CD48 mAb (Cat# MBS666325).

Product Categories/Family for hCD244 recombinant protein

Human Recombinant Proteins

Applications Tested/Suitable for hCD244 recombinant protein

Flow Cytometry (FC/FACS), ELISA (EIA)

Product References and Citations for hCD244 recombinant protein

1) Boles KS, Mathew PA, et al. (1999) Tissue Antigens 54(1): 27-34. 2) Mak A, AM Fairhurst, et al. (2017) Clinical Rheumatology 37(3): 811-816. doi.org/10.1007/s10067-017-3698-2. 3) Vacca P, MC Mingarri, et al. (2006) Blood 108: 4078-4085. 4) Munitz A, Levi-Schaffer F, et al. (2005) J Immunol 174(1): 110-118. 5) Zhang F, Zheng J, et al. (2017) Haematologica Doi: 10.3324/haematol.2016.151555.

Other Notes

Small volumes of hCD244 recombinant protein vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for hCD244 purchase

MBS666941 is a recombinant protein targeting hCD244. Also known as Recombinant hCD244 (2B4)-muCD8 Purified (Preservative-free).