• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Crystallin Beta B3 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS838962

Rabbit polyclonal Crystallin Beta B3 antibody raised against the middle region of CRYBB3 More details

$1110 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Crystallin Beta B3, Polyclonal Antibody
Full Product Name
Crystallin Beta B3 antibody
Product Synonym Names
Polyclonal Crystallin Beta B3; Anti-Crystallin Beta B3; CATCN2; MGC125772; MGC125774; CRYB3; CRYBB3; MGC125773
Clonality
Polyclonal
Host
Rabbit
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRYBB3 antibody in PBS
Purity/Purification
Affinity purified
Concentration
1 mg/ml (lot specific)
Specificity
Crystallin Beta B3 antibody was raised against the middle region of CRYBB3
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Molecular Weight
24 kDa (MW of target protein)
Cross-Reactivity
Human, Mouse, Rat
Immunogen
Crystallin Beta B3 antibody was raised using the middle region of CRYBB3 corresponding to a region with amino acids LNIDSPHHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASVRAING

Product Categories/Family for anti-Crystallin Beta B3 antibody

Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-Crystallin Beta B3 antibody
Western Blot (WB)
Application Notes for anti-Crystallin Beta B3 antibody
WB: 0.2-1 ug/ml

Western Blot (WB) of anti-Crystallin Beta B3 antibody

Western Blot showing Crystallin Beta B3 antibody used at a concentration of 1-2 ug/ml to detect its target protein.
Rabbit Anti-Crystallin Beta B3 Polyclonal Antibody – Cat# MBS838962

Other Notes

Small volumes of anti-Crystallin Beta B3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for Crystallin Beta B3 purchase

MBS838962 is an antibody targeting Crystallin Beta B3. Also known as Crystallin Beta B3 antibody. Host: Rabbit.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000