• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

NMUR2 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS838998

MBS838998 is an antibody targeting NMUR2. Also known as NMUR2 antibody. Host: Rabbit. Rabbit polyclonal NMUR2 antibody raised against the N terminal of NMUR2 More details

$990 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
NMUR2, Polyclonal Antibody
Full Product Name
NMUR2 antibody
Product Gene Name
anti-NMUR2 antibody
Product Synonym Names
Polyclonal NMUR2; Anti-NMUR2; protein-coupled receptor fm4; NMUR2; tgr-1; Neuromedin U Receptor 2; neuromedin u receptor-type 2; neuromedin S receptor; NMUR 2; neuromedin u receptor 2; nmu-r2; NMUR-2; SNORF62; nmu2r
Clonality
Polyclonal
Host
Rabbit
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NMUR2 antibody in PBS
Purity/Purification
Total IgG Protein A purified
Concentration
1 mg/ml (lot specific)
Specificity
NMUR2 antibody was raised against the N terminal of NMUR2
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Molecular Weight
46 kDa (MW of target protein)
Cross-Reactivity
Human
Immunogen
NMUR2 antibody was raised using the N terminal of NMUR2 corresponding to a region with amino acids MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV

Product Categories/Family for anti-NMUR2 antibody

Neuroscience; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-NMUR2 antibody
Western Blot (WB)
Application Notes for anti-NMUR2 antibody
WB: 2.5 ug/ml

Western Blot (WB) of anti-NMUR2 antibody

NMUR2 antibody (MBS838998) used at 2.5 ug/ml to detect target protein.
Rabbit Anti-NMUR2 Polyclonal Antibody – Cat# MBS838998

Other Notes

Small volumes of anti-NMUR2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for NMUR2. It may not necessarily be applicable to this product.

NCBI GI #
31543326
NCBI GeneID
216749
NCBI Accession #
NP_694719.2
UniProt Secondary Accession #
Q91Z76
UniProt Related Accession #
Q8BZ39
GenBank Nucleotide #
NM_153079.4
NCBI Official Full Name
neuromedin-U receptor 2
NCBI Official Synonym Full Names
neuromedin U receptor 2
NCBI Official Symbol
Nmur2
NCBI Official Synonym Symbols
Nmu2r
UniProt Protein Name
Neuromedin-U receptor 2
Protein Family
Neuromedin-U receptor
UniProt Gene Name
Nmur2
UniProt Synonym Gene Names
NMU-R2
UniProt Entry Name
NMUR2_MOUSE
NCBI Protein Information
neuromedin-U receptor 2

UniProt Comments for NMUR2

NMUR2: Receptor for the neuromedin-U and neuromedin-S neuropeptides. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Cellular Component: membrane; cell; plasma membrane; integral to membrane; intracellular; cytosol

Molecular Function: G-protein coupled receptor activity; neuropeptide receptor activity; signal transducer activity; intracellular calcium activated chloride channel activity; GTP binding; neuromedin U receptor activity; neuromedin U binding

Biological Process: grooming behavior; inositol phosphate-mediated signaling; chloride transport; response to pain; signal transduction; arachidonic acid secretion; reduction of food intake in response to dietary excess; synaptic transmission; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; neuropeptide signaling pathway; calcium ion transport; calcium-dependent phospholipase A2 activation; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating)
Show more

Research Articles on NMUR2

1. The present data do not support a significant contribution of NMUR2 to the development of hypersensitivity after nerve injury or tissue inflammation

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-NMUR2 antibody

 Reference Product  PubMed Publications
 Nmu antibody  >29 publications with NMUR2 and Nmu
 Nms antibody  >8 publications with NMUR2 and Nms

Pathways associated with anti-NMUR2 antibody

 Products by Pathway  Pathway Diagram
 Class A/1 (Rhodopsin-like Receptors) Pathway antibodies  Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
 G Alpha (i) Signalling Events Pathway antibodies  G Alpha (i) Signalling Events Pathway Diagram
 G Alpha (q) Signalling Events Pathway antibodies  G Alpha (q) Signalling Events Pathway Diagram
 GPCR Downstream Signaling Pathway antibodies  GPCR Downstream Signaling Pathway Diagram
 GPCR Ligand Binding Pathway antibodies  GPCR Ligand Binding Pathway Diagram
 Gastrin-CREB Signalling Pathway Via PKC And MAPK antibodies  Gastrin-CREB Signalling Pathway Via PKC And MAPK Diagram
 Neuroactive Ligand-receptor Interaction Pathway antibodies  Neuroactive Ligand-receptor Interaction Pathway Diagram
 Neuroactive Ligand-receptor Interaction Pathway antibodies  Neuroactive Ligand-receptor Interaction Pathway Diagram
 Non-odorant GPCRs Pathway antibodies  Non-odorant GPCRs Pathway Diagram
 Peptide Ligand-binding Receptors Pathway antibodies  Peptide Ligand-binding Receptors Pathway Diagram

Diseases associated with anti-NMUR2 antibody

 Disease Name  Pubmed Publications
 Weight Loss Antibodies  >4 publications with NMUR2 and Weight Loss
 Neurologic Manifestations Antibodies  >3 publications with NMUR2 and Neurologic Manifestations
 Inflammation Antibodies  >3 publications with NMUR2 and Inflammation
 Insulin Resistance Antibodies  >2 publications with NMUR2 and Insulin Resistance
 Eating Disorders Antibodies  >2 publications with NMUR2 and Eating Disorders
 Hypersensitivity Antibodies  >1 publications with NMUR2 and Hypersensitivity
 Hypertension Antibodies  >1 publications with NMUR2 and Hypertension

Organs/Tissues associated with anti-NMUR2 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >15 publications with NMUR2 and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000