• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Annexin A7 (ANXA7) Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS839273

MBS839273 is an antibody targeting Anxa7. Also known as Annexin A7 antibody. Host: Rabbit. Rabbit polyclonal Annexin A7 antibody raised against the N terminal of ANXA7 More details

$990 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Annexin A7 (Anxa7), Polyclonal Antibody
Full Product Name
Annexin A7 antibody
Product Gene Name
anti-Anxa7 antibody
Product Synonym Names
Polyclonal Annexin A7; Anti-Annexin A7; ANXA7; Annexin A7; Annexin A-7; Annexin A 7
Clonality
Polyclonal
Host
Rabbit
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ANXA7 antibody in PBS
Purity/Purification
Total IgG Protein A purified
Concentration
1 mg/ml (lot specific)
Specificity
Annexin A7 antibody was raised against the N terminal of ANXA7
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Molecular Weight
51 kDa (MW of target protein)
Cross-Reactivity
Human
Immunogen
Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP

Product Categories/Family for anti-Anxa7 antibody

Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-Anxa7 antibody
Western Blot (WB)
Application Notes for anti-Anxa7 antibody
WB: 2.5 ug/ml

Western Blot (WB) of anti-Anxa7 antibody

Annexin A7 antibody (MBS839273) used at 2.5 ug/ml to detect target protein.
Rabbit Anti-ANXA7 Polyclonal Antibody – Cat# MBS839273

Other Notes

Small volumes of anti-Anxa7 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for Anxa7. It may not necessarily be applicable to this product.

NCBI GI #
160707958
NCBI GeneID
11750
NCBI Accession #
NP_001104264.1
UniProt Secondary Accession #
Q3TT33
UniProt Related Accession #
Q07076
GenBank Nucleotide #
NM_001110794.1
NCBI Official Full Name
annexin A7
NCBI Official Synonym Full Names
annexin A7
NCBI Official Symbol
Anxa7
NCBI Official Synonym Symbols
Anx7; synexin; AI265384; AI316497
UniProt Protein Name
Annexin A7
UniProt Synonym Protein Names
Annexin VII; Annexin-7; Synexin
Protein Family
Annexin
UniProt Gene Name
Anxa7
UniProt Synonym Gene Names
Anx7
UniProt Entry Name
ANXA7_MOUSE
NCBI Protein Information
annexin A7

UniProt Comments for Anxa7

ANXA7: Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. Interacts with PDCD6. Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta. Belongs to the annexin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid-binding; Motility/polarity/chemotaxis; Calcium-binding

Cellular Component: endoplasmic reticulum membrane; membrane; cell; plasma membrane; nuclear envelope; cytosol; nucleus; vesicle

Molecular Function: integrin binding; protein binding; calcium-dependent phospholipid binding; calcium ion binding; calcium-dependent protein binding

Biological Process: cellular calcium ion homeostasis; cell proliferation; regulation of cell shape; cellular water homeostasis; hemostasis; autophagy; response to calcium ion; response to organic cyclic substance; response to salt stress
Show more

Research Articles on Anxa7

1. Annexin A7 and galectin-3 are involved in cell migration and invasion regulation in mouse hepatocellular carcinoma cell lines.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-Anxa7 antibody

 Reference Product  PubMed Publications
 Lgals3 antibody  >2 publications with Anxa7 and Lgals3
 Gca antibody  >1 publications with Anxa7 and Gca
 Sri antibody  >1 publications with Anxa7 and Sri

Diseases associated with anti-Anxa7 antibody

 Disease Name  Pubmed Publications
 Liver Neoplasms Antibodies  >8 publications with Anxa7 and Liver Neoplasms
 Liver Diseases Antibodies  >7 publications with Anxa7 and Liver Diseases
 Carcinoma, Hepatocellular Antibodies  >6 publications with Anxa7 and Carcinoma, Hepatocellular
 Genital Diseases, Male Antibodies  >6 publications with Anxa7 and Genital Diseases, Male
 Disease Models, Animal Antibodies  >5 publications with Anxa7 and Disease Models, Animal
 Nervous System Diseases Antibodies  >5 publications with Anxa7 and Nervous System Diseases
 Liver Neoplasms, Experimental Antibodies  >2 publications with Anxa7 and Liver Neoplasms, Experimental
 Poisoning Antibodies  >1 publications with Anxa7 and Poisoning
 Anemia Antibodies  >1 publications with Anxa7 and Anemia
 Hypertrophy Antibodies  >1 publications with Anxa7 and Hypertrophy

Organs/Tissues associated with anti-Anxa7 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >10 publications with Anxa7 and Brain
 Liver Antibodies  >8 publications with Anxa7 and Liver
 Prostate Antibodies  >7 publications with Anxa7 and Prostate
 Lymph Node Antibodies  >6 publications with Anxa7 and Lymph Node
 Muscle Antibodies  >5 publications with Anxa7 and Muscle
 Blood Antibodies  >5 publications with Anxa7 and Blood
 Heart Antibodies  >4 publications with Anxa7 and Heart
 Pancreas Antibodies  >2 publications with Anxa7 and Pancreas
 Embryonic Tissue Antibodies  >2 publications with Anxa7 and Embryonic Tissue
 Joint Antibodies  >1 publications with Anxa7 and Joint
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000