Rabbit Anti-SEPT12 Polyclonal Antibody – Cat# MBS839555

Septin 12 antibody (MBS839555) used at 1 ug/ml to detect target protein.

Septin 12 (SEPT12) Antibody – Rabbit Polyclonal

Name: SEPT12 Antibody; Polyclonal; Rabbit; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS839555
Price: 1110 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS839555

MBS839555 is an antibody targeting SEPT12. Also known as Septin 12 antibody. Reactive in Human, Mouse, Rat. Host: Rabbit. Rabbit polyclonal Septin 12 antibody raised against the middle region of 40433 More details

$1110 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Septin 12 (SEPT12), Polyclonal Antibody

Full Product Name

Septin 12 antibody

Product Gene Name

anti-SEPT12 antibody

Product Synonym Names

Polyclonal Septin 12; Anti-Septin 12; Septin 12; FLJ25410; Septin -12; 41153

Clonality

Polyclonal

Host

Rabbit

Species Reactivity

Human, Mouse, Rat

Form/Format

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 41153 antibody in PBS

Purity/Purification

Affinity purified

Concentration

1 mg/ml (lot specific)

Specificity

Septin 12 antibody was raised against the middle region of 40433

Preparation and Storage

Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Molecular Weight

41 kDa (MW of target protein)

OMIM

611562

Cross-Reactivity

Human,Mouse,Rat

Immunogen

Septin 12 antibody was raised using the middle region of 40433 corresponding to a region with amino acids LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD

Product Categories/Family for anti-SEPT12 antibody

Cell Cycle & Cell Death; Purified Polyclonal Antibodies

Applications Tested/Suitable for anti-SEPT12 antibody

Western Blot (WB)

Application Notes for anti-SEPT12 antibody

WB: 1 ug/ml

Other Notes

Small volumes of anti-SEPT12 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for SEPT12. It may not necessarily be applicable to this product.

NCBI GI #

23242699

NCBI GeneID

124404

NCBI Accession #

AAH35619.1

UniProt Secondary Accession #

Q0P6B0; Q1PBH0; Q96LL0

UniProt Related Accession #

Q8IYM1

NCBI Official Full Name

Septin 12

NCBI Official Synonym Full Names

septin 12

NCBI Official Symbol

SEPT12

NCBI Official Synonym Symbols

SPGF10

UniProt Protein Name

Septin-12

Protein Family

Septin

UniProt Gene Name

SEPT12

UniProt Entry Name

SEP12_HUMAN

NCBI Protein Information

septin-12

NCBI Summary for SEPT12

This gene encodes a guanine-nucleotide binding protein and member of the septin family of cytoskeletal GTPases. Septins play important roles in cytokinesis, exocytosis, embryonic development, and membrane dynamics. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

UniProt Comments for SEPT12

SEPT12: Filament-forming cytoskeletal GTPase. May play a role in cytokinesis (Potential). Defects in SEPT12 are the cause of spermatogenic failure 10 (SPGF10). An infertility disorder caused by spermatogenesis defects. It results in decreased sperm motility, concentration, and multiple sperm structural defects. The most prominent feature is a defective sperm annulus, a ring structure that demarcates the midpiece and the principal piece of the sperm tail. Belongs to the septin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal; Cell cycle regulation; Hydrolase

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: microtubule cytoskeleton; perinuclear region of cytoplasm; stress fiber; spindle; midbody; cleavage furrow

Molecular Function: protein binding; GDP binding; protein homodimerization activity; GTP binding; phosphoinositide binding

Biological Process: cell division; cell cycle

Disease: Spermatogenic Failure 10

Research Articles on SEPT12

1. we discovered that the SEPTIN12-microtubule complexes are critical for sperm formation during spermiogenesis

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-SEPT12 antibody

Reference Product	PubMed Publications
SEPT6 antibody	>4 publications with SEPT12 and SEPT6
SEPT5 antibody	>2 publications with SEPT12 and SEPT5
SEPT11 antibody	>2 publications with SEPT12 and SEPT11
SEPT1 antibody	>2 publications with SEPT12 and SEPT1
SEPT8 antibody	>1 publications with SEPT12 and SEPT8
SEPT10 antibody	>1 publications with SEPT12 and SEPT10
SEPT14 antibody	>1 publications with SEPT12 and SEPT14

Pathways associated with anti-SEPT12 antibody

Products by Pathway	Pathway Diagram
Bacterial Invasion Of Epithelial Cells Pathway antibodies	Bacterial Invasion Of Epithelial Cells Pathway Diagram
Bacterial Invasion Of Epithelial Cells Pathway antibodies	Bacterial Invasion Of Epithelial Cells Pathway Diagram

Diseases associated with anti-SEPT12 antibody

Disease Name	Pubmed Publications
Inflammation Antibodies	>1 publications with SEPT12 and Inflammation

Organs/Tissues associated with anti-SEPT12 antibody

Organ/Tissue Name	Pubmed Publications
Testis Antibodies	>6 publications with SEPT12 and Testis
Brain Antibodies	>1 publications with SEPT12 and Brain