Rabbit Anti-VASH1 Polyclonal Antibody – Cat# MBS839713

Vasohibin 1 antibody (MBS839713) used at 1 ug/ml to detect target protein.

Vasohibin 1 (VASH1) Antibody – Rabbit Polyclonal

Name: VASH1 Antibody; Polyclonal; Rabbit; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS839713
Price: 1110 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS839713

MBS839713 is an antibody targeting VASH1. Also known as Vasohibin 1 antibody. Reactive in Human, Mouse, Rat. Host: Rabbit. Rabbit polyclonal Vasohibin 1 antibody raised against the N terminal of VASH1 More details

$1110 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Vasohibin 1 (VASH1), Polyclonal Antibody

Full Product Name

Vasohibin 1 antibody

Product Gene Name

anti-VASH1 antibody

Product Synonym Names

Polyclonal Vasohibin 1; Anti-Vasohibin 1; Vasohibin -1; Vasohibin 1; KIAA1036; VASH1

Clonality

Polyclonal

Host

Rabbit

Species Reactivity

Human, Mouse, Rat

Form/Format

Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VASH1 antibody in PBS

Purity/Purification

Affinity purified

Concentration

1 mg/ml (lot specific)

Specificity

Vasohibin 1 antibody was raised against the N terminal of VASH1

Preparation and Storage

Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Molecular Weight

41 kDa (MW of target protein)

OMIM

609011

Cross-Reactivity

Human,Mouse,Rat

Immunogen

Vasohibin 1 antibody was raised using the N terminal of VASH1 corresponding to a region with amino acids ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER

Product Categories/Family for anti-VASH1 antibody

Cancer; Purified Polyclonal Antibodies

Applications Tested/Suitable for anti-VASH1 antibody

Western Blot (WB)

Application Notes for anti-VASH1 antibody

WB: 1 ug/ml

Other Notes

Small volumes of anti-VASH1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for VASH1. It may not necessarily be applicable to this product.

NCBI GI #

7662454

NCBI GeneID

22846

NCBI Accession #

NP_055724.1

UniProt Secondary Accession #

Q96H02; Q9UBF4; Q9Y629

UniProt Related Accession #

Q7L8A9

GenBank Nucleotide #

NM_014909.4

NCBI Official Full Name

vasohibin-1

NCBI Official Synonym Full Names

vasohibin 1

NCBI Official Symbol

VASH1

NCBI Official Synonym Symbols

KIAA1036

UniProt Protein Name

Vasohibin-1

Protein Family

Vasohibin

UniProt Gene Name

VASH1

UniProt Synonym Gene Names

KIAA1036; VASH

UniProt Entry Name

VASH1_HUMAN

NCBI Protein Information

vasohibin-1

UniProt Comments for VASH1

VASH1: Angiogenesis inhibitor. Inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. Does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. Acts in an autocrine manner. Inhibits artery neointimal formation and macrophage infiltration. Exhibits heparin-binding activity. Belongs to the vasohibin family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: extracellular space; apical part of cell; endoplasmic reticulum; cytoplasm

Biological Process: negative regulation of angiogenesis; negative regulation of endothelial cell proliferation; response to wounding; angiogenesis; negative regulation of blood vessel endothelial cell migration; cell cycle arrest

Research Articles on VASH1

1. VASH1 and VASH2 showed distinctive localization and opposing function on the fetoplacental vascularization.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-VASH1 antibody

Reference Product	PubMed Publications
VEGFA antibody	>10 publications with VASH1 and VEGFA
ANGPTL6 antibody	>1 publications with VASH1 and ANGPTL6

Diseases associated with anti-VASH1 antibody

Disease Name	Pubmed Publications
Vascular Diseases Antibodies	>10 publications with VASH1 and Vascular Diseases
Adenocarcinoma Antibodies	>9 publications with VASH1 and Adenocarcinoma
Cardiovascular Diseases Antibodies	>7 publications with VASH1 and Cardiovascular Diseases
Kidney Diseases Antibodies	>6 publications with VASH1 and Kidney Diseases
Neoplasm Metastasis Antibodies	>4 publications with VASH1 and Neoplasm Metastasis
Liver Neoplasms Antibodies	>3 publications with VASH1 and Liver Neoplasms
Breast Neoplasms Antibodies	>3 publications with VASH1 and Breast Neoplasms
Lung Neoplasms Antibodies	>3 publications with VASH1 and Lung Neoplasms
Hypertrophy Antibodies	>3 publications with VASH1 and Hypertrophy
Inflammation Antibodies	>3 publications with VASH1 and Inflammation

Organs/Tissues associated with anti-VASH1 antibody

Organ/Tissue Name	Pubmed Publications
Vascular Antibodies	>61 publications with VASH1 and Vascular
Blood Antibodies	>28 publications with VASH1 and Blood
Eye Antibodies	>8 publications with VASH1 and Eye
Muscle Antibodies	>7 publications with VASH1 and Muscle
Lung Antibodies	>6 publications with VASH1 and Lung
Lymph Node Antibodies	>5 publications with VASH1 and Lymph Node
Bone Antibodies	>5 publications with VASH1 and Bone
Embryonic Tissue Antibodies	>4 publications with VASH1 and Embryonic Tissue
Ovary Antibodies	>2 publications with VASH1 and Ovary
Placenta Antibodies	>2 publications with VASH1 and Placenta