• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Beta Tubulin 2a Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS839827

Rabbit polyclonal Beta Tubulin 2A antibody raised against the middle region of TUBB2A More details

$1120 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Beta Tubulin 2A, Polyclonal Antibody
Full Product Name
Beta Tubulin 2A antibody
Product Synonym Names
Polyclonal Beta Tubulin 2A; Anti-Beta Tubulin 2A; TUBB; TUBB2; dJ40E16.7; TUBB2A
Clonality
Polyclonal
Host
Rabbit
Species Reactivity
Human, Mouse, Rat, Arabidopsis, Drosophila
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TUBB2A antibody in PBS
Purity/Purification
Affinity purified
Concentration
1 mg/ml (lot specific)
Specificity
Beta Tubulin 2A antibody was raised against the middle region of TUBB2A
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Molecular Weight
49 kDa (MW of target protein)
Cross-Reactivity
Human,Mouse,Rat,Arabidopsis,Drosophila
Immunogen
Beta Tubulin 2A antibody was raised using the middle region of TUBB2A corresponding to a region with amino acids AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC

Product Categories/Family for anti-Beta Tubulin 2A antibody

Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-Beta Tubulin 2A antibody
Western Blot (WB)
Application Notes for anti-Beta Tubulin 2A antibody
WB: 1 ug/ml

Western Blot (WB) of anti-Beta Tubulin 2A antibody

Rabbit Anti-Beta Tubulin 2a Polyclonal Antibody – Cat# MBS839827

Immunohistochemistry (IHC) of anti-Beta Tubulin 2A antibody

Small intestine, myenteric plexus
Rabbit Anti-Beta Tubulin 2a Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS839827

Other Notes

Small volumes of anti-Beta Tubulin 2A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for Beta Tubulin 2A purchase

MBS839827 is an antibody targeting Beta Tubulin 2A. Also known as Beta Tubulin 2A antibody. Reactive in Human, Mouse, Rat, Arabidopsis, Drosophila. Host: Rabbit.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000