• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

Ephrin-B1 (EFNB1) Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS839890

MBS839890 is an antibody targeting EFNB1. Also known as Ephrin-B1 antibody. Host: Rabbit. Rabbit polyclonal Ephrin-B1 antibody raised against the middle region of EFNB1 More details

$1110 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Ephrin-B1 (EFNB1), Polyclonal Antibody
Full Product Name
Ephrin-B1 antibody
Product Gene Name
anti-EFNB1 antibody
Product Synonym Names
Polyclonal Ephrin-B1; Anti-Ephrin-B1; LERK2; MGC8782; CFNS; Elk-L; CFND; EPLG2; EFNB1; EFL3
Clonality
Polyclonal
Host
Rabbit
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EFNB1 antibody in PBS
Purity/Purification
Affinity purified
Concentration
1 mg/ml (lot specific)
Specificity
Ephrin-B1 antibody was raised against the middle region of EFNB1
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Molecular Weight
35 kDa (MW of target protein)
OMIM
300035
Cross-Reactivity
Human, Mouse
Immunogen
Ephrin-B1 antibody was raised using the middle region of EFNB1 corresponding to a region with amino acids SRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSG

Product Categories/Family for anti-EFNB1 antibody

Signal Transduction; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-EFNB1 antibody
Western Blot (WB)
Application Notes for anti-EFNB1 antibody
WB: 1 ug/ml

Western Blot (WB) of anti-EFNB1 antibody

Ephrin-B1 antibody (MBS839890) used at 1 ug/ml to detect target protein.
Rabbit Anti-EFNB1 Polyclonal Antibody – Cat# MBS839890

Other Notes

Small volumes of anti-EFNB1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for EFNB1. It may not necessarily be applicable to this product.

NCBI GI #
4758248
NCBI GeneID
1947
NCBI Accession #
NP_004420.1
UniProt Secondary Accession #
D3DVU0
UniProt Related Accession #
P98172
GenBank Nucleotide #
NM_004429.4
NCBI Official Full Name
ephrin-B1
NCBI Official Synonym Full Names
ephrin-B1
NCBI Official Symbol
EFNB1
NCBI Official Synonym Symbols
CFND; CFNS; EFB1; EFL3; EPLG2; Elk-L; LERK2
UniProt Protein Name
Ephrin-B1
UniProt Synonym Protein Names
EFL-3; ELK ligand; ELK-L; EPH-related receptor tyrosine kinase ligand 2; LERK-2
Protein Family
Ephrin
UniProt Gene Name
EFNB1
UniProt Synonym Gene Names
EFL3; EPLG2; LERK2; ELK-L; LERK-2
UniProt Entry Name
EFNB1_HUMAN
NCBI Protein Information
ephrin-B1

NCBI Summary for EFNB1

The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system. [provided by RefSeq, Jul 2008]

UniProt Comments for EFNB1

EFNB1: a type I membrane protein of the ephrin family. A ligand of Eph-related receptor tyrosine kinases EphB1 and EphA1. Ephrins and ephrin receptors mediate numerous developmental processes, particularly in the nervous system. Ephrin-B1 may play a role in cell adhesion and functions in the development or maintenance of the nervous system. Binding to its receptor induces the collapse of commissural axons/growth cones in vitro. Induced by TNF-alpha. Expressed in brain, heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas.

Protein type: Membrane protein, integral; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: Xq12

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane; synapse; nucleus; lipid raft

Molecular Function: protein binding; ephrin receptor binding

Biological Process: axon guidance; cell-cell signaling; ephrin receptor signaling pathway; positive regulation of T cell proliferation; embryonic pattern specification; cell adhesion; neural crest cell migration

Disease: Craniofrontonasal Syndrome
Show more

Research Articles on EFNB1

1. EphB2/ephrin-B1 were invoked in dental pulp stem cells with TNF-alpha treatment via the JNK-dependent pathway, but not NF-kB, p38 MAPK or MEK signalling.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-EFNB1 antibody

 Reference Product  PubMed Publications
 EPHB2 antibody  >15 publications with EFNB1 and EPHB2
 EPHB1 antibody  >11 publications with EFNB1 and EPHB1
 EPHB4 antibody  >7 publications with EFNB1 and EPHB4
 EPHB3 antibody  >4 publications with EFNB1 and EPHB3
 SRC antibody  >3 publications with EFNB1 and SRC
 PTPN13 antibody  >2 publications with EFNB1 and PTPN13
 EPHA1 antibody  >1 publications with EFNB1 and EPHA1
 RGS3 antibody  >1 publications with EFNB1 and RGS3

Pathways associated with anti-EFNB1 antibody

 Products by Pathway  Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 Developmental Biology Pathway antibodies  Developmental Biology Pathway Diagram
 EPH-Ephrin Signaling Pathway antibodies  EPH-Ephrin Signaling Pathway Diagram
 EPH-ephrin Mediated Repulsion Of Cells Pathway antibodies  EPH-ephrin Mediated Repulsion Of Cells Pathway Diagram
 EPHB Forward Signaling Pathway antibodies  EPHB Forward Signaling Pathway Diagram
 EPHB-mediated Forward Signaling Pathway antibodies  EPHB-mediated Forward Signaling Pathway Diagram
 Ephrin B Reverse Signaling Pathway antibodies  Ephrin B Reverse Signaling Pathway Diagram
 Ephrin Signaling Pathway antibodies  Ephrin Signaling Pathway Diagram

Diseases associated with anti-EFNB1 antibody

 Disease Name  Pubmed Publications
 Craniosynostoses Antibodies  >16 publications with EFNB1 and Craniosynostoses
 Hypertelorism Antibodies  >15 publications with EFNB1 and Hypertelorism
 Craniofrontonasal dysplasia Antibodies  >10 publications with EFNB1 and Craniofrontonasal dysplasia
 Frontonasal dysplasia Antibodies  >8 publications with EFNB1 and Frontonasal dysplasia
 Abnormalities, Multiple Antibodies  >7 publications with EFNB1 and Abnormalities, Multiple
 Nervous System Diseases Antibodies  >7 publications with EFNB1 and Nervous System Diseases
 Necrosis Antibodies  >4 publications with EFNB1 and Necrosis
 Skin Diseases Antibodies  >4 publications with EFNB1 and Skin Diseases
 Brain Diseases Antibodies  >4 publications with EFNB1 and Brain Diseases
 Inflammation Antibodies  >4 publications with EFNB1 and Inflammation

Organs/Tissues associated with anti-EFNB1 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >22 publications with EFNB1 and Brain
 Bone Antibodies  >20 publications with EFNB1 and Bone
 Vascular Antibodies  >8 publications with EFNB1 and Vascular
 Embryonic Tissue Antibodies  >8 publications with EFNB1 and Embryonic Tissue
 Eye Antibodies  >4 publications with EFNB1 and Eye
 Connective Tissue Antibodies  >4 publications with EFNB1 and Connective Tissue
 Muscle Antibodies  >4 publications with EFNB1 and Muscle
 Spleen Antibodies  >3 publications with EFNB1 and Spleen
 Mouth Antibodies  >3 publications with EFNB1 and Mouth
 Ovary Antibodies  >2 publications with EFNB1 and Ovary
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000