• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

KLF4 Antibody – Rabbit Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1751212

Description: Rabbit IgG polyclonal antibody for KLF4 detection. Tested with WB, IHC-P in Human; Mouse; Rat.Background: Kruppel-like factor 4, also known as EZF or GKLF, is a protein that in humans is encoded by the KLF4 gene. This gene is mapped to 9q31.2.… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
KLF4, Polyclonal Antibody
Full Product Name
Anti-KLF4 Antibody
Product Gene Name
anti-KLF4 antibody
Product Synonym Names
Krueppel-like factor 4; Epithelial zinc finger protein EZF; Gut-enriched krueppel-like factor; KLF4; EZF; GKLF; Kruppel-like factor 4 (gut)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized
Purity/Purification
Immunogen Affinity Purified
Specificity
No cross reactivity with other proteins.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Molecular Weight
51,076 Da
3D Structure
ModBase 3D Structure for O43474
Immunogen
A synthetic peptide corresponding to a sequence of human KLF4 (EKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLA).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-KLF4 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-KLF4 antibody
WB: 0.1-0.5 mug/ml
IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.

Western Blot (WB) of anti-KLF4 antibody

Figure 1. Western blot analysis of KLF4 using anti-KLF4 antibody.
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human COLO-320 whole cell lysates,
Lane 3: rat stomach tissue lysates,
Lane 4: rat testis tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-KLF4 antigen affinity purified polyclonal antibody at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for KLF4 at approximately 60KD. The expected band size for KLF4 is at 55KD.
Rabbit Anti-KLF4 Polyclonal Antibody – Cat# MBS1751212

Immunohistochemistry (IHC) of anti-KLF4 antibody

Figure 3. IHC analysis of KLF4 using anti-KLF4 antibody.
KLF4 was detected in paraffin-embedded section of mouse spleen tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/mL rabbit anti-KLF4 antibody.
KLF4 was detected in paraffin-embedded section of mouse spleen tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 ug/mL rabbit anti-KLF4 Antibody overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Rabbit Anti-KLF4 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS1751212

Product References and Citations for anti-KLF4 antibody

1. Moore, D. L., Blackmore, M. G., Hu, Y., Kaestner, K. H., Bixby, J. L., Lemmon, V. P., Goldberg, J. L. KLF family members regulate intrinsic axon regeneration ability. Science 326: 298-301, 2009. 2. Patel, S., Xi, Z. F., Seo, E. Y., McGaughey, D., Segre, J. A. Klf4 and corticosteroids activate an overlapping set of transcriptional targets to accelerate in utero epidermal barrier acquisition. Proc. Nat. Acad. Sci. 103: 18668-18673, 2006. 3. Wang, H., Yang, L., Jamaluddin, M. S., Boyd, D. D. The Kruppel-like KLF4 transcription factor, a novel regulator of urokinase receptor expression, drives synthesis of this binding site in colonic crypt luminal surface epithelial cells. J. Biol. Chem. 279: 22674-22683, 2004.

Other Notes

Small volumes of anti-KLF4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for KLF4 purchase

MBS1751212 is an antibody targeting KLF4. Reactive in Human, Mouse, Rat. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for KLF4. It may not necessarily be applicable to this product.

NCBI GI #
930697457
NCBI GeneID
9314
NCBI Accession #
NP_001300981.1
UniProt Primary Accession #
O43474
UniProt Secondary Accession #
P78338; Q5T3J8; Q5T3J9; Q8N717; Q9UNP3; B2R8S4; B3KT79; L0R3I6; L0R4N5
UniProt Related Accession #
O43474
GenBank Nucleotide #
NM_001314052.1
NCBI Official Full Name
Krueppel-like factor 4 isoform 1
NCBI Official Synonym Full Names
Kruppel like factor 4
NCBI Official Symbol
KLF4
NCBI Official Synonym Symbols
EZF; GKLF
UniProt Protein Name
Krueppel-like factor 4
UniProt Synonym Protein Names
Epithelial zinc finger protein EZF; Gut-enriched krueppel-like factor
Protein Family
Krueppel-like factor
UniProt Gene Name
KLF4
UniProt Synonym Gene Names
EZF; GKLF
NCBI Protein Information
Krueppel-like factor 4

NCBI Summary for KLF4

This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]
Show more

UniProt Comments for KLF4

Transcription factor; can act both as activator and as repressor. Binds the 5'-CACCC-3' core sequence. Binds to the promoter region of its own gene and can activate its own transcription. Regulates the expression of key transcription factors during embryonic development. Plays an important role in maintaining embryonic stem cells, and in preventing their differentiation. Required for establishing the barrier function of the skin and for postnatal maturation and maintenance of the ocular surface. Involved in the differentiation of epithelial cells and may also function in skeletal and kidney development. Contributes to the down-regulation of p53/TP53 transcription.
Show more

Research Articles on KLF4

1. Human and mouse WNT10A mutant palmoplantar and tongue epithelia also display specific differentiation defects that are mimicked by loss of the transcription factor KLF4.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-KLF4 antibody

 Products by Pathway  Pathway Diagram
 Developmental Biology Pathway antibodies  Developmental Biology Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram
 Peptide Hormone Metabolism Pathway antibodies  Peptide Hormone Metabolism Pathway Diagram
 Regulation Of Wnt-mediated Beta Catenin Signaling And Target Gene Transcription Pathway antibodies  Regulation Of Wnt-mediated Beta Catenin Signaling And Target Gene Transcription Pathway Diagram
 SRF And MiRs In Smooth Muscle Differentiation And Proliferation Pathway antibodies  SRF And MiRs In Smooth Muscle Differentiation And Proliferation Pathway Diagram
 Signaling Pathways Regulating Pluripotency Of Stem Cells antibodies  Signaling Pathways Regulating Pluripotency Of Stem Cells Diagram
 Signaling Pathways Regulating Pluripotency Of Stem Cells antibodies  Signaling Pathways Regulating Pluripotency Of Stem Cells Diagram
 Synthesis, Secretion, And Deacylation Of Ghrelin Pathway antibodies  Synthesis, Secretion, And Deacylation Of Ghrelin Pathway Diagram
 Transcriptional Regulation Of Pluripotent Stem Cells Pathway antibodies  Transcriptional Regulation Of Pluripotent Stem Cells Pathway Diagram
 Transcriptional Regulation Of White Adipocyte Differentiation Pathway antibodies  Transcriptional Regulation Of White Adipocyte Differentiation Pathway Diagram

Diseases associated with anti-KLF4 antibody

 Disease Name  Pubmed Publications
 Cardiovascular Diseases Antibodies  >100 publications with KLF4 and Cardiovascular Diseases
 Nervous System Diseases Antibodies  >90 publications with KLF4 and Nervous System Diseases
 Disease Models, Animal Antibodies  >79 publications with KLF4 and Disease Models, Animal
 Inflammation Antibodies  >71 publications with KLF4 and Inflammation
 Breast Neoplasms Antibodies  >51 publications with KLF4 and Breast Neoplasms
 Heart Diseases Antibodies  >39 publications with KLF4 and Heart Diseases
 Carcinoma, Squamous Cell Antibodies  >33 publications with KLF4 and Carcinoma, Squamous Cell
 Neoplasms, Experimental Antibodies  >27 publications with KLF4 and Neoplasms, Experimental
 Necrosis Antibodies  >22 publications with KLF4 and Necrosis
 Liver Neoplasms Antibodies  >22 publications with KLF4 and Liver Neoplasms

Organs/Tissues associated with anti-KLF4 antibody

 Organ/Tissue Name  Pubmed Publications
 Embryonic Tissue Antibodies  >233 publications with KLF4 and Embryonic Tissue
 Skin Antibodies  >145 publications with KLF4 and Skin
 Vascular Antibodies  >142 publications with KLF4 and Vascular
 Heart Antibodies  >99 publications with KLF4 and Heart
 Brain Antibodies  >87 publications with KLF4 and Brain
 Liver Antibodies  >73 publications with KLF4 and Liver
 Eye Antibodies  >62 publications with KLF4 and Eye
 Lung Antibodies  >62 publications with KLF4 and Lung
 Intestine Antibodies  >54 publications with KLF4 and Intestine
 Kidney Antibodies  >42 publications with KLF4 and Kidney
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000