• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ACTN3 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS1752228

Description: Mouse IgG monoclonal antibody for ACTN3 detection. Tested with WB, IHC-P in Mouse; Rat.Background: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ACTN3, Monoclonal Antibody
Full Product Name
Anti-ACTN3 Antibody (monoclonal, 9B5)
Product Gene Name
anti-ACTN3 antibody
Product Synonym Names
Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3; Actinin alpha 3 (gene/pseudogene)
Clonality
Monoclonal
Isotype
IgG1
Host
Mouse
Species Reactivity
Mouse, Rat
Form/Format
Lyophilized
Purity/Purification
Immunogen Affinity Purified
Specificity
No cross reactivity with other proteins.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Molecular Weight
103,241 Da
3D Structure
ModBase 3D Structure for Q08043
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-ACTN3 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-ACTN3 antibody
WB: 0.1-0.5 mug/ml
IHC-P: 0.5-1 mug/ml
Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.

Western Blot (WB) of anti-ACTN3 antibody

Figure 1. Western blot analysis of ACTN3 using anti-ACTN3 antibody (M02693).
Electrophoresis was performed on a 10% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat skeletal muscle tissue,
Lane 2: mouse skeletal muscle tissue.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-ACTN3 antigen affinity purified monoclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
Mouse Anti-ACTN3 Monoclonal Antibody – Cat# MBS1752228

Product References and Citations for anti-ACTN3 antibody

1. Papadimitriou ID, Papadopoulos C, Kouvatsi A, Triantaphyllidis C (April 2008). "The ACTN3 gene in elite Greek track and field athletes". Int J Sports Med 29 (4): 352-5. 2. Yang N, MacArthur DG, Gulbin JP, Hahn AG, Beggs AH, Easteal S, North K (September 2003). "ACTN3 genotype is associated with human elite athletic performance". Am. J. Hum. Genet. 73 (3): 627-31.

Other Notes

Small volumes of anti-ACTN3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ACTN3 purchase

MBS1752228 is an antibody targeting ACTN3. Also known as Anti-ACTN3 Antibody (monoclonal, 9B5). Reactive in Mouse, Rat. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ACTN3. It may not necessarily be applicable to this product.

NCBI GI #
585866354
NCBI GeneID
89
NCBI Accession #
NP_001095.2
UniProt Primary Accession #
Q08043
UniProt Secondary Accession #
Q4KKV2; A6NP77
UniProt Related Accession #
Q08043
GenBank Nucleotide #
NM_001104.4
NCBI Official Full Name
alpha-actinin-3 isoform 1
NCBI Official Synonym Full Names
actinin alpha 3 (gene/pseudogene)
NCBI Official Symbol
ACTN3
NCBI Official Synonym Symbols
ACTN3D
UniProt Protein Name
Alpha-actinin-3
UniProt Synonym Protein Names
Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein
Protein Family
Alpha-actinin
UniProt Gene Name
ACTN3
NCBI Protein Information
alpha-actinin-3

NCBI Summary for ACTN3

This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status. [provided by RefSeq, Feb 2014]
Show more

UniProt Comments for ACTN3

F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.

Research Articles on ACTN3

1. ACTN3 is a genetic modifier of Duchenne muscular dystrophy.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-ACTN3 antibody

 Products by Pathway  Pathway Diagram
 Adherens Junction Pathway antibodies  Adherens Junction Pathway Diagram
 Adherens Junction Pathway antibodies  Adherens Junction Pathway Diagram
 Amoebiasis Pathway antibodies  Amoebiasis Pathway Diagram
 Amoebiasis Pathway antibodies  Amoebiasis Pathway Diagram
 Arrhythmogenic Right Ventricular Cardiomyopathy Pathway antibodies  Arrhythmogenic Right Ventricular Cardiomyopathy Pathway Diagram
 Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway antibodies  Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway Diagram
 Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway antibodies  Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway Diagram
 Cell-Cell Communication Pathway antibodies  Cell-Cell Communication Pathway Diagram
 Focal Adhesion Pathway antibodies  Focal Adhesion Pathway Diagram
 Focal Adhesion Pathway antibodies  Focal Adhesion Pathway Diagram

Diseases associated with anti-ACTN3 antibody

 Disease Name  Pubmed Publications
 Atrophy Antibodies  >5 publications with ACTN3 and Atrophy
 Hypertrophy Antibodies  >4 publications with ACTN3 and Hypertrophy
 Kidney Diseases Antibodies  >3 publications with ACTN3 and Kidney Diseases
 Inflammation Antibodies  >2 publications with ACTN3 and Inflammation
 Ovarian Diseases Antibodies  >2 publications with ACTN3 and Ovarian Diseases
 Ovarian Neoplasms Antibodies  >2 publications with ACTN3 and Ovarian Neoplasms
 Congenital Abnormalities Antibodies  >1 publications with ACTN3 and Congenital Abnormalities
 Fetal Death Antibodies  >1 publications with ACTN3 and Fetal Death
 Breast Neoplasms Antibodies  >1 publications with ACTN3 and Breast Neoplasms
 Fibrosis Antibodies  >1 publications with ACTN3 and Fibrosis

Organs/Tissues associated with anti-ACTN3 antibody

 Organ/Tissue Name  Pubmed Publications
 Muscle Antibodies  >141 publications with ACTN3 and Muscle
 Heart Antibodies  >7 publications with ACTN3 and Heart
 Bone Antibodies  >6 publications with ACTN3 and Bone
 Embryonic Tissue Antibodies  >3 publications with ACTN3 and Embryonic Tissue
 Eye Antibodies  >1 publications with ACTN3 and Eye
 Testis Antibodies  >1 publications with ACTN3 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000