• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

AHSG Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS177852

Description: Rabbit IgG polyclonal antibody for Alpha-2-HS-glycoprotein(AHSG) detection. Tested with WB, IHC-P, ELISA in Human;Rat.Background: Alpha-2-HS-glycoprotein (AHSG), also known as fetuin-A, is a protein that in humans is encoded by the AHSG gene.… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
AHSG, Polyclonal Antibody
Full Product Name
Anti-AHSG Antibody
Product Gene Name
anti-AHSG antibody
Product Synonym Names
Alpha-2-HS-glycoprotein; 59 kDa bone sialic acid-containing protein; A2HS; Aa2-066; AHS; Ahsg alpha-2-HS-glycoprotein; Ahsg; Alpha 2 HS Glycoprotein; Alpha 2 Z globulin; Alpha-2-HS-glycoprotein; Alpha-2-HS-glycoprotein chain B; Alpha-2-Z-globulin; Asialofetuin; Ba alpha 2 glycoprotein; Ba-alpha-2-glycoprotein; BSP; Countertrypin; Fetua; FETUA_HUMAN; Fetuin, mouse, homolog of; Fetuin A; Fetuin-A; Glycoprotein PP63; HSGA; pp63; alpha-2-HS-glycoprotein
Clonality
Polyclonal
Species Reactivity
Human, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
39,325 Da
OMIM
138680
3D Structure
ModBase 3D Structure for P02765
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human AHSG (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-AHSG antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA)
Application Notes for anti-AHSG antibody
ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-AHSG antibody

Figure 1. Western blot analysis of AHSG using anti-AHSG antibody (MBS177852).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: Rat Brain Tissue Lysate,
Lane 2: RH35 Whole Cell Lysate,
Lane 3: MCF-7 Whole Cell Lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AHSG antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for AHSG at approximately 58KD. The expected band size for AHSG is at 39KD.
Anti-AHSG Polyclonal Antibody – Cat# MBS177852

Immunohistochemistry (IHC) of anti-AHSG antibody

Figure 2. IHC analysis of AHSG using anti-AHSG antibody (MBS177852).
AHSG was detected in paraffin-embedded section of Human Liver Cancer Tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-AHSG Antibody (MBS177852) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Anti-AHSG Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS177852

Flow Cytometry (FC/FACS) of anti-AHSG antibody

Figure 3. Flow Cytometry analysis of HEPG2 cells using anti-Fetuin A antibody (MBS177852).
Overlay histogram showing HEPG2 cells stained with MBS177852 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Fetuin A Antibody (MBS177852,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Anti-AHSG Polyclonal Antibody, Flow Cytometry (FC/FACS) – Cat# MBS177852

Product References and Citations for anti-AHSG antibody

1. "Entrez Gene: AHSG alpha-2-HS-glycoprotein". 2. Osawa M, Umetsu K, Sato M, Ohki T, Yukawa N, Suzuki T, Takeichi S (September 1997). "Structure of the gene encoding human alpha 2-HS glycoprotein (AHSG)". Gene 196 (1-2): 121-5. 3. Rizzu P, Baldini A (1995). "Three members of the human cystatin gene superfamily, AHSG, HRG, and KNG, map within one megabase of genomic DNA at 3q27". Cytogenet. Cell Genet. 70 (1-2): 26-8.

Other Notes

Small volumes of anti-AHSG antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for AHSG purchase

MBS177852 is an antibody targeting AHSG. Reactive in Human, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for AHSG. It may not necessarily be applicable to this product.

NCBI GI #
156523970
NCBI GeneID
197
NCBI Accession #
NP_001613.2
UniProt Primary Accession #
P02765
UniProt Secondary Accession #
O14961; O14962; Q9P152; A8K9N6; B2R7G1
UniProt Related Accession #
P02765; AAB29984
GenBank Nucleotide #
NM_001622.2
NCBI Official Full Name
alpha-2-HS-glycoprotein preproprotein
NCBI Official Synonym Full Names
alpha-2-HS-glycoprotein
NCBI Official Symbol
AHSG
NCBI Official Synonym Symbols
AHS; A2HS; HSGA; FETUA
UniProt Protein Name
Alpha-2-HS-glycoprotein
UniProt Synonym Protein Names
Alpha-2-Z-globulin; Ba-alpha-2-glycoprotein; Fetuin-A
Protein Family
Alpha-2-HS-glycoprotein
UniProt Gene Name
AHSG
UniProt Synonym Gene Names
FETUA
UniProt Entry Name
FETUA_HUMAN
NCBI Protein Information
alpha-2-HS-glycoprotein

NCBI Summary for AHSG

Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for AHSG

FETUA: Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions. Alpha-2-HS glycoprotein derives from this precursor, when the connecting peptide is cleaved off. The two chains A and B are held together by a single disulfide bond. Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins. Belongs to the fetuin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 3q27

Cellular Component: extracellular matrix; extracellular region; extracellular space

Molecular Function: cysteine protease inhibitor activity; endopeptidase inhibitor activity; kinase inhibitor activity

Biological Process: acute-phase response; negative regulation of bone mineralization; negative regulation of insulin receptor signaling pathway; negative regulation of phosphorylation; ossification; pinocytosis; platelet degranulation; positive regulation of phagocytosis; regulation of bone mineralization; regulation of inflammatory response; skeletal development
Show more

Research Articles on AHSG

1. The study findings showed that plasma sCD40L, fetuin-A, and PAPP-A levels are associated with carotid plaque formation and instability.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-AHSG antibody

 Reference Product  PubMed Publications
 BMP2 antibody  >2 publications with AHSG and BMP2
 BMP4 antibody  >1 publications with AHSG and BMP4

Pathways associated with anti-AHSG antibody

 Products by Pathway  Pathway Diagram
 BMP Receptor Signaling Pathway antibodies  BMP Receptor Signaling Pathway Diagram
 Hemostasis Pathway antibodies  Hemostasis Pathway Diagram
 Platelet Activation, Signaling And Aggregation Pathway antibodies  Platelet Activation, Signaling And Aggregation Pathway Diagram
 Platelet Degranulation Pathway antibodies  Platelet Degranulation Pathway Diagram
 Response To Elevated Platelet Cytosolic Ca2+ Pathway antibodies  Response To Elevated Platelet Cytosolic Ca2+ Pathway Diagram

Diseases associated with anti-AHSG antibody

 Disease Name  Pubmed Publications
 Cardiovascular Diseases Antibodies  >154 publications with AHSG and Cardiovascular Diseases
 Kidney Diseases Antibodies  >117 publications with AHSG and Kidney Diseases
 Calcinosis Antibodies  >104 publications with AHSG and Calcinosis
 Inflammation Antibodies  >87 publications with AHSG and Inflammation
 Liver Diseases Antibodies  >49 publications with AHSG and Liver Diseases
 Hypertension Antibodies  >24 publications with AHSG and Hypertension
 Fatty Liver Antibodies  >20 publications with AHSG and Fatty Liver
 Liver Neoplasms Antibodies  >19 publications with AHSG and Liver Neoplasms
 Myocardial Infarction Antibodies  >16 publications with AHSG and Myocardial Infarction
 Necrosis Antibodies  >14 publications with AHSG and Necrosis

Organs/Tissues associated with anti-AHSG antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >516 publications with AHSG and Blood
 Liver Antibodies  >101 publications with AHSG and Liver
 Heart Antibodies  >44 publications with AHSG and Heart
 Muscle Antibodies  >31 publications with AHSG and Muscle
 Brain Antibodies  >19 publications with AHSG and Brain
 Lung Antibodies  >12 publications with AHSG and Lung
 Spleen Antibodies  >4 publications with AHSG and Spleen
 Embryonic Tissue Antibodies  >4 publications with AHSG and Embryonic Tissue
 Thymus Antibodies  >2 publications with AHSG and Thymus
 Testis Antibodies  >2 publications with AHSG and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000