• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

FUT1 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178100

Description: Rabbit IgG polyclonal antibody for Galactoside 2-alpha-L-fucosyltransferase 1(FUT1) detection. Tested with WB, IHC-P in Human;Mouse; Rat. Background: Galactoside 2-alpha-L-fucosyltransferase 1 is an enzyme that in humans is encoded by the FUT1… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
FUT1, Polyclonal Antibody
Full Product Name
Anti-FUT1 Antibody
Product Gene Name
anti-FUT1 antibody
Product Synonym Names
Galactoside 2-alpha-L-fucosyltransferase 1; 2)FT 1; 2-alpha-L-fucosyltransferase; Alpha (1 2) fucosyltransferase; Alpha(1 2)FT 1; Alpha(1; Blood group H alpha 2-fucosyltransferase; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); Fucosyltransferase 1; FUT1; FUT1_HUMAN; Galactoside 2 alpha L fucosyltransferase; Galactoside 2-alpha-L-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; H; HH; HSC; Para Bombay phenotype; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
41,251 Da
OMIM
211100
3D Structure
ModBase 3D Structure for P19526
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FUT1 (134-164aa EVDSRTPWRELQLHDWMSEEYADLRDPFLKL), different from the related mouse and rat sequences by seven amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-FUT1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-FUT1 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-FUT1 antibody

Anti- FUT1 Picoband antibody, MBS178100, Western blotting
All lanes: Anti FUT1 (MBS178100) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: SW620 Whole Cell Lysate at 40ug
Lane 3: A549 Whole Cell Lysate at 40ug
Predicted bind size: 50KD
Observed bind size: 50KD
Anti-FUT1 Polyclonal Antibody – Cat# MBS178100

Immunohistochemistry (IHC) of anti-FUT1 antibody

Anti- FUT1 Picoband antibody, MBS178100, IHC(P)
IHC(P): Mouse Intestine Tissue
Anti-FUT1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178100

Immunohistochemistry (IHC) of anti-FUT1 antibody

Anti- FUT1 Picoband antibody, MBS178100, IHC(P)
IHC(P): Rat Intestine Tissue
Anti-FUT1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178100

Immunohistochemistry (IHC) of anti-FUT1 antibody

Anti- FUT1 Picoband antibody, MBS178100, IHC(P)
IHC(P): Human Mammary Cancer Tissue
Anti-FUT1 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178100

Product References and Citations for anti-FUT1 antibody

1. "Entrez Gene: FUT1 fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group)". 2. Ball SP, Tongue N, Gibaud A et al. (1992). "The human chromosome 19 linkage group FUT1 (H), FUT2 (SE), LE, LU, PEPD, C3, APOC2, D19S7 and D19S9". Ann. Hum. Genet. 55 (Pt 3): 225-33. 3. Yip SP, Chee KY, Chan PY et al. (2003). "Molecular genetic analysis of para-Bombay phenotypes in Chinese: a novel non-functional FUT1 allele is identified". Vox Sang. 83 (3): 258-62.

Other Notes

Small volumes of anti-FUT1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for FUT1 purchase

MBS178100 is an antibody targeting FUT1. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for FUT1. It may not necessarily be applicable to this product.

NCBI GI #
4503805
NCBI GeneID
2523
NCBI Accession #
NP_000139.1
UniProt Primary Accession #
P19526
UniProt Secondary Accession #
O14505; O14506; O14507
UniProt Related Accession #
P19526
GenBank Nucleotide #
NM_000148.3
NCBI Official Full Name
galactoside 2-alpha-L-fucosyltransferase 1
NCBI Official Synonym Full Names
fucosyltransferase 1 (H blood group)
NCBI Official Symbol
FUT1
NCBI Official Synonym Symbols
H; HH; HSC
UniProt Protein Name
Galactoside 2-alpha-L-fucosyltransferase 1
UniProt Synonym Protein Names
Alpha(1,2)FT 1; Blood group H alpha 2-fucosyltransferase; Fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1
Protein Family
Galactoside 2-alpha-L-fucosyltransferase
UniProt Gene Name
FUT1
UniProt Synonym Gene Names
H; HSC
UniProt Entry Name
FUT1_HUMAN
NCBI Protein Information
galactoside 2-alpha-L-fucosyltransferase 1

NCBI Summary for FUT1

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for FUT1

FUT1: Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values. Belongs to the glycosyltransferase 11 family.

Protein type: Glycan Metabolism - glycosphingolipid biosynthesis - lacto and neolacto series; Membrane protein, integral; Transferase; EC 2.4.1.69; Glycan Metabolism - glycosphingolipid biosynthesis - globo series

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: Golgi apparatus; integral to plasma membrane; membrane

Molecular Function: fucosyltransferase activity; galactoside 2-alpha-L-fucosyltransferase activity

Biological Process: carbohydrate metabolic process; L-fucose catabolic process; protein amino acid glycosylation
Show more

Research Articles on FUT1

1. We show that fut1 in RA synovial fibroblasts is important in angiogenesis, leukocyte-synovial fibroblast adhesion, and synovial fibroblast proliferation

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-FUT1 antibody

 Products by Pathway  Pathway Diagram
 Ganglio Sphingolipid Metabolism Pathway antibodies  Ganglio Sphingolipid Metabolism Pathway Diagram
 Glycosphingolipid Biosynthesis - Globo Series Pathway antibodies  Glycosphingolipid Biosynthesis - Globo Series Pathway Diagram
 Glycosphingolipid Biosynthesis - Globo Series Pathway antibodies  Glycosphingolipid Biosynthesis - Globo Series Pathway Diagram
 Glycosphingolipid Biosynthesis - Lacto And Neolacto Series Pathway antibodies  Glycosphingolipid Biosynthesis - Lacto And Neolacto Series Pathway Diagram
 Glycosphingolipid Biosynthesis - Lacto And Neolacto Series Pathway antibodies  Glycosphingolipid Biosynthesis - Lacto And Neolacto Series Pathway Diagram
 Metabolic Pathways antibodies  Metabolic Pathways Diagram

Diseases associated with anti-FUT1 antibody

 Disease Name  Pubmed Publications
 Edema Antibodies  >14 publications with FUT1 and Edema
 Inflammation Antibodies  >7 publications with FUT1 and Inflammation
 Lung Diseases Antibodies  >3 publications with FUT1 and Lung Diseases
 Liver Diseases Antibodies  >3 publications with FUT1 and Liver Diseases
 Hyperplasia Antibodies  >2 publications with FUT1 and Hyperplasia
 Necrosis Antibodies  >2 publications with FUT1 and Necrosis
 Nervous System Diseases Antibodies  >1 publications with FUT1 and Nervous System Diseases
 Lung Neoplasms Antibodies  >1 publications with FUT1 and Lung Neoplasms
 Carcinoma, Hepatocellular Antibodies  >1 publications with FUT1 and Carcinoma, Hepatocellular
 Cardiovascular Diseases Antibodies  >1 publications with FUT1 and Cardiovascular Diseases

Organs/Tissues associated with anti-FUT1 antibody

 Organ/Tissue Name  Pubmed Publications
 Intestine Antibodies  >17 publications with FUT1 and Intestine
 Stomach Antibodies  >10 publications with FUT1 and Stomach
 Uterus Antibodies  >10 publications with FUT1 and Uterus
 Lung Antibodies  >9 publications with FUT1 and Lung
 Bone Antibodies  >8 publications with FUT1 and Bone
 Brain Antibodies  >6 publications with FUT1 and Brain
 Liver Antibodies  >5 publications with FUT1 and Liver
 Spleen Antibodies  >4 publications with FUT1 and Spleen
 Embryonic Tissue Antibodies  >4 publications with FUT1 and Embryonic Tissue
 Testis Antibodies  >2 publications with FUT1 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000