• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

IGFBP3 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178228

Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human;Rat.Background: IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
IGFBP3, Polyclonal Antibody
Full Product Name
Anti-IGFBP3 Antibody
Product Gene Name
anti-IGFBP3 antibody
Product Synonym Names
Insulin-like growth factor-binding protein 3; Acid stable subunit of the 140 K IGF complex; Binding protein 29; Binding protein 53; BP 53; BP53; Growth hormone dependent binding protein; IBP 3; IBP-3; IBP3; IBP3_HUMAN; IGF binding protein 3; IGF-binding protein 3; IGFBP 3; IGFBP-3; IGFBP3; Insulin Like Growth Factor Binding Protein 3; Insulin-like growth factor-binding protein 3; insulin-like growth factor binding protein 3
Clonality
Polyclonal
Species Reactivity
Human, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
32,223 Da
OMIM
146732
3D Structure
ModBase 3D Structure for P17936
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-IGFBP3 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA)
Application Notes for anti-IGFBP3 antibody
ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-IGFBP3 antibody

Anti- IGFBP-3 Picoband antibody, MBS178228, Western blotting
All lanes: Anti IGFBP-3 (MBS178228) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Rat Liver Tissue Lysate at 50ug
Lane 3: SGC Whole Cell Lysate at 40ug
Lane 4: 22RV1 Whole Cell Lysate at 40ug
Predicted bind size: 31KD
Observed bind size: 31KD
Anti-IGFBP3 Polyclonal Antibody – Cat# MBS178228

Immunohistochemistry (IHC) of anti-IGFBP3 antibody

Anti- IGFBP-3 Picoband antibody, MBS178228, IHC(P)
IHC(P): Human Intestinal Cancer Tissue
Anti-IGFBP3 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178228

Product References and Citations for anti-IGFBP3 antibody

1. Lofqvist, C., Chen, J., Connor, K. M., Smith, A. C. H., Aderman, C. M., Liu, N., Pintar, J. E., Ludwig, T., Hellstrom, A., Smith, L. E. H. IGFBP3 suppresses retinopathy through suppression of oxygen-induced vessel loss and promotion of vascular regrowth.Proc. Nat. Acad. Sci. 104: 10589-10594, 2007. 2. Nwosu BU, et al. Evidence of insulin-like growth factor binding protein-3 proteolysis during growth hormone stimulation testing. J Pediatr Endocrinol Metab, 2011. 3. Relationship of insulin-like growth factor (IGF) binding protein-3 (IGFBP-3) gene polymorphism with the susceptibility to development of prostate cancer and influence on serum levels of IGF-I, and IGFBP-3. Safarinejad MR, et al. Growth Horm IGF Res, 2011 Jun.

Other Notes

Small volumes of anti-IGFBP3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for IGFBP3 purchase

MBS178228 is an antibody targeting IGFBP3. Reactive in Human, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for IGFBP3. It may not necessarily be applicable to this product.

NCBI GI #
62243068
NCBI GeneID
3486
NCBI Accession #
NP_000589.2
UniProt Primary Accession #
P17936
UniProt Secondary Accession #
Q2V509; Q6P1M6; Q9UCL4; A4D2F5; D3DVM0
UniProt Related Accession #
P17936
GenBank Nucleotide #
NM_000598.4
NCBI Official Full Name
insulin-like growth factor-binding protein 3 isoform b
NCBI Official Synonym Full Names
insulin like growth factor binding protein 3
NCBI Official Symbol
IGFBP3
NCBI Official Synonym Symbols
IBP3; BP-53
UniProt Protein Name
Insulin-like growth factor-binding protein 3
Protein Family
Insulin-like growth factor-binding protein
UniProt Gene Name
IGFBP3
UniProt Synonym Gene Names
IBP3; IBP-3; IGF-binding protein 3; IGFBP-3
UniProt Entry Name
IBP3_HUMAN
NCBI Protein Information
insulin-like growth factor-binding protein 3

NCBI Summary for IGFBP3

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for IGFBP3

IGFBP3: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R.

Protein type: Secreted; Cell development/differentiation; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7p12.3

Cellular Component: extracellular region; extracellular space; insulin-like growth factor binding protein complex; nucleus

Molecular Function: fibronectin binding; insulin-like growth factor binding; insulin-like growth factor I binding; insulin-like growth factor II binding; metal ion binding; protein binding; protein tyrosine phosphatase activator activity

Biological Process: apoptosis; cellular protein metabolic process; negative regulation of cell proliferation; negative regulation of protein amino acid phosphorylation; negative regulation of signal transduction; negative regulation of smooth muscle cell migration; negative regulation of smooth muscle cell proliferation; osteoblast differentiation; positive regulation of apoptosis; positive regulation of catalytic activity; positive regulation of insulin-like growth factor receptor signaling pathway; positive regulation of MAPKKK cascade; positive regulation of myoblast differentiation; protein amino acid phosphorylation; regulation of apoptosis; regulation of cell growth; regulation of insulin-like growth factor receptor signaling pathway
Show more

Research Articles on IGFBP3

1. Methylation of IGFBP-3 in colorectal cancer was identified to be significantly associated with risk of recurrence.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-IGFBP3 antibody

 Reference Product  PubMed Publications
 IGF1 antibody  >282 publications with IGFBP3 and IGF1
 IGF2 antibody  >88 publications with IGFBP3 and IGF2
 IGFALS antibody  >22 publications with IGFBP3 and IGFALS
 TP53 antibody  >14 publications with IGFBP3 and TP53
 MMP2 antibody  >7 publications with IGFBP3 and MMP2
 ADAM12 antibody  >4 publications with IGFBP3 and ADAM12
 MAPK8 antibody  >1 publications with IGFBP3 and MAPK8

Pathways associated with anti-IGFBP3 antibody

 Products by Pathway  Pathway Diagram
 Direct P53 Effectors Pathway antibodies  Direct P53 Effectors Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Generic Transcription Pathway antibodies  Generic Transcription Pathway Diagram
 Integrated Pancreatic Cancer Pathway antibodies  Integrated Pancreatic Cancer Pathway Diagram
 Metabolism Of Proteins Pathway antibodies  Metabolism Of Proteins Pathway Diagram
 Myometrial Relaxation And Contraction Pathways antibodies  Myometrial Relaxation And Contraction Pathways Diagram
 Regulation Of Insulin-like Growth Factor (IGF) Transport And Uptake By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway antibodies  Regulation Of Insulin-like Growth Factor (IGF) Transport And Uptake By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway Diagram
 Senescence And Autophagy Pathway antibodies  Senescence And Autophagy Pathway Diagram
 TP53 Regulates Transcription Of Cell Death Genes Pathway antibodies  TP53 Regulates Transcription Of Cell Death Genes Pathway Diagram
 TP53 Regulates Transcription Of Death Receptors And Ligands Pathway antibodies  TP53 Regulates Transcription Of Death Receptors And Ligands Pathway Diagram

Diseases associated with anti-IGFBP3 antibody

 Disease Name  Pubmed Publications
 Breast Neoplasms Antibodies  >368 publications with IGFBP3 and Breast Neoplasms
 Prostatic Neoplasms Antibodies  >267 publications with IGFBP3 and Prostatic Neoplasms
 Cardiovascular Diseases Antibodies  >248 publications with IGFBP3 and Cardiovascular Diseases
 Liver Diseases Antibodies  >159 publications with IGFBP3 and Liver Diseases
 Colorectal Neoplasms Antibodies  >157 publications with IGFBP3 and Colorectal Neoplasms
 Lung Diseases Antibodies  >149 publications with IGFBP3 and Lung Diseases
 Weight Gain Antibodies  >148 publications with IGFBP3 and Weight Gain
 Inflammation Antibodies  >142 publications with IGFBP3 and Inflammation
 Kidney Diseases Antibodies  >126 publications with IGFBP3 and Kidney Diseases
 Disease Models, Animal Antibodies  >125 publications with IGFBP3 and Disease Models, Animal

Organs/Tissues associated with anti-IGFBP3 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >2953 publications with IGFBP3 and Blood
 Bone Antibodies  >536 publications with IGFBP3 and Bone
 Liver Antibodies  >451 publications with IGFBP3 and Liver
 Prostate Antibodies  >366 publications with IGFBP3 and Prostate
 Muscle Antibodies  >310 publications with IGFBP3 and Muscle
 Vascular Antibodies  >239 publications with IGFBP3 and Vascular
 Connective Tissue Antibodies  >228 publications with IGFBP3 and Connective Tissue
 Brain Antibodies  >220 publications with IGFBP3 and Brain
 Kidney Antibodies  >209 publications with IGFBP3 and Kidney
 Lung Antibodies  >196 publications with IGFBP3 and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000