• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ZP2 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178234

Description: Rabbit IgG polyclonal antibody for Zona pellucida sperm-binding protein 2(ZP2) detection. Tested with WB, IHC-P in Human.Background: Zona pellucida sperm-binding protein 2 is a protein that in humans is encoded by the ZP2 gene. The sperm-binding… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ZP2, Polyclonal Antibody
Full Product Name
Anti-ZP2 Antibody
Product Gene Name
anti-ZP2 antibody
Product Synonym Names
Zona pellucida sperm-binding protein 2; OTTHUMP00000115849; Processed zona pellucida sperm-binding protein 2; Zona pellucida glycoprotein 2; zona pellucida glycoprotein ZP2; Zona pellucida protein A; Zp-2; ZP2; ZP2_HUMAN; ZPA; zona pellucida glycoprotein 2 (sperm receptor)
Clonality
Polyclonal
Species Reactivity
Human
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
81,300 Da
OMIM
182888
3D Structure
ModBase 3D Structure for Q05996
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ZP2 (511-544aa ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-ZP2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-ZP2 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-ZP2 antibody

Western blot analysis of ZP2 expression in HELA whole cell lysates (lane 1) and HEPG2 whole cell lysates (lane 2). ZP2 at 82KD was detected using rabbit anti- ZP2 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
Anti-ZP2 Polyclonal Antibody – Cat# MBS178234

Immunohistochemistry (IHC) of anti-ZP2 antibody

ZP2 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- ZP2 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.
Anti-ZP2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178234

Immunohistochemistry (IHC) of anti-ZP2 antibody

Figure 3. IHC analysis of ZP2 using anti-ZP2 antibody (MBS178234).
ZP2 was detected in frozen section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-ZP2 Antibody (MBS178234) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
Anti-ZP2 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178234

Product References and Citations for anti-ZP2 antibody

1. "Entrez Gene: ZP2 zona pellucida glycoprotein 2 (sperm receptor)". 2. Burkart AD, Xiong B, Baibakov B, Jiménez-Movilla M, Dean J. "Ovastacin, a cortical granule protease, cleaves ZP2 in the zona pellucida to prevent polyspermy.". J Cell Biol 197: 37-44. 3. Liang LF, Dean J (Apr 1993). "Conservation of mammalian secondary sperm receptor genes enables the promoter of the human gene to function in mouse oocytes". Dev Biol 156 (2): 399-408.

Other Notes

Small volumes of anti-ZP2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ZP2 purchase

MBS178234 is an antibody targeting ZP2. Reactive in Human.

Additional Details

NCBI/Uniprot data below describe general gene information for ZP2. It may not necessarily be applicable to this product.

NCBI GI #
588282802
NCBI GeneID
7783
NCBI Accession #
NP_001277033.1
UniProt Primary Accession #
Q05996
UniProt Secondary Accession #
Q4VAN9; Q4VAP0; Q4VAP1; B2R7J2
UniProt Related Accession #
Q05996
GenBank Nucleotide #
NM_001290104.1
NCBI Official Full Name
zona pellucida sperm-binding protein 2 isoform 2 preproprotein
NCBI Official Synonym Full Names
zona pellucida glycoprotein 2
NCBI Official Symbol
ZP2
NCBI Official Synonym Symbols
ZPA; Zp-2
UniProt Protein Name
Zona pellucida sperm-binding protein 2
UniProt Synonym Protein Names
Zona pellucida glycoprotein 2; Zp-2
Protein Family
Zona pellucida sperm-binding protein
UniProt Gene Name
ZP2
UniProt Synonym Gene Names
ZPA; Zp-2
UniProt Entry Name
ZP2_HUMAN
NCBI Protein Information
zona pellucida sperm-binding protein 2

NCBI Summary for ZP2

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed of three glycoproteins with various functions during fertilization and preimplantation development. The glycosylated mature peptide is one of the structural components of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. Female mice lacking this gene do not form a stable zona matrix and are sterile. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
Show more

UniProt Comments for ZP2

ZP2: The mammalian zona pellucida, which mediates species- specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor. Belongs to the ZP domain family. ZPA subfamily.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 16p12

Cellular Component: endoplasmic reticulum; extracellular matrix; extracellular region; Golgi apparatus; integral to membrane; multivesicular body; plasma membrane; proteinaceous extracellular matrix; secretory granule

Molecular Function: acrosin binding; coreceptor activity

Biological Process: binding of sperm to zona pellucida; intracellular protein transport; manganese ion transport; regulation of acrosome reaction; signal transduction
Show more

Research Articles on ZP2

1. ZP2(51-149) sperm-binding domain is necessary for human gamete recognition and penetration through the zona pellucida.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ZP2 antibody

 Reference Product  PubMed Publications
 ZP3 antibody  >207 publications with ZP2 and ZP3
 ZP1 antibody  >150 publications with ZP2 and ZP1
 ZP4 antibody  >52 publications with ZP2 and ZP4

Pathways associated with anti-ZP2 antibody

 Products by Pathway  Pathway Diagram
 Fertilization Pathway antibodies  Fertilization Pathway Diagram
 Interaction With The Zona Pellucida Pathway antibodies  Interaction With The Zona Pellucida Pathway Diagram
 Ovarian Infertility Genes Pathway antibodies  Ovarian Infertility Genes Pathway Diagram
 Reproduction Pathway antibodies  Reproduction Pathway Diagram

Diseases associated with anti-ZP2 antibody

 Disease Name  Pubmed Publications
 Infertility, Female Antibodies  >21 publications with ZP2 and Infertility, Female
 Kidney Diseases Antibodies  >14 publications with ZP2 and Kidney Diseases
 Infertility, Male Antibodies  >13 publications with ZP2 and Infertility, Male
 Chromosome Aberrations Antibodies  >2 publications with ZP2 and Chromosome Aberrations
 Adenocarcinoma Antibodies  >1 publications with ZP2 and Adenocarcinoma
 Aneuploidy Antibodies  >1 publications with ZP2 and Aneuploidy
 Feminization Antibodies  >1 publications with ZP2 and Feminization
 Fetal Death Antibodies  >1 publications with ZP2 and Fetal Death

Organs/Tissues associated with anti-ZP2 antibody

 Organ/Tissue Name  Pubmed Publications
 Testis Antibodies  >9 publications with ZP2 and Testis
 Brain Antibodies  >4 publications with ZP2 and Brain
 Uterus Antibodies  >3 publications with ZP2 and Uterus
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000