• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PGP9.5 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178319

Description: Rabbit IgG polyclonal antibody for Ubiquitin carboxyl-terminal hydrolase isozyme L1(UCHL1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Background: UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
PGP9.5, Polyclonal Antibody
Full Product Name
Anti-PGP9.5 Antibody
Product Gene Name
anti-PGP9.5 antibody
Product Synonym Names
Ubiquitin carboxyl-terminal hydrolase isozyme L1; Neuron cytoplasmic protein 9.5; OTTHUMP00000218137; OTTHUMP00000218139; OTTHUMP00000218140; OTTHUMP00000218141; Park 5; PARK5; PGP 9.5; PGP9.5; PGP95; Protein gene product 9.5; Ubiquitin C terminal esterase L1; Ubiquitin C terminal hydrolase; Ubiquitin carboxyl terminal esterase L1; Ubiquitin carboxyl terminal hydrolase isozyme L1; Ubiquitin carboxyl-terminal hydrolase isozyme L1; Ubiquitin thioesterase L1; Ubiquitin thiolesterase; Ubiquitin thiolesterase L1; UCH-L1; UCHL1; UCHL1_HUMAN; ubiquitin C-terminal hydrolase L1
Clonality
Polyclonal
Species Reactivity
Human, Mouse, Rat
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
24,824 Da
OMIM
191342
3D Structure
ModBase 3D Structure for P09936
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-PGP9.5 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-PGP9.5 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-PGP9.5 antibody

Anti- PGP9.5 Picoband antibody, MBS178319, Western blotting
All lanes: Anti PGP9.5 (MBS178319) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Lane 3: U87 Whole Cell Lysate at 40ug
Predicted bind size: 25KD
Observed bind size: 25KD
Anti-PGP9.5 Polyclonal Antibody – Cat# MBS178319

Immunohistochemistry (IHC) of anti-PGP9.5 antibody

Anti- PGP9.5 Picoband antibody, MBS178319, IHC(P)
IHC(P): Mouse Brain Tissue
Anti-PGP9.5 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178319

Immunohistochemistry (IHC) of anti-PGP9.5 antibody

Anti- PGP9.5 Picoband antibody, MBS178319, IHC(P)
IHC(P): Rat Brain Tissue
Anti-PGP9.5 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178319

Immunohistochemistry (IHC) of anti-PGP9.5 antibody

Anti- PGP9.5 Picoband antibody, MBS178319, IHC(P)
IHC(P): Human Glioma Tissue
Anti-PGP9.5 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178319

Product References and Citations for anti-PGP9.5 antibody

1. "Entrez Gene: UCHL1 ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)". 2. Das C, Hoang QQ, Kreinbring CA, Luchansky SJ, Meray RK, Ray SS, Lansbury PT, Ringe D, Petsko GA (Mar 2006). "Structural basis for conformational plasticity of the Parkinson's disease-associated ubiquitin hydrolase UCH-L1". Proceedings of the National Academy of Sciences of the United States of America 103 (12): 4675-80. 3. Doran JF, Jackson P, Kynoch PA, Thompson RJ (Jun 1983). "Isolation of PGP 9.5, a new human neurone-specific protein detected by high-resolution two-dimensional electrophoresis". Journal of Neurochemistry 40 (6): 1542-7.

Other Notes

Small volumes of anti-PGP9.5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PGP9.5 purchase

MBS178319 is an antibody targeting PGP9.5. Reactive in Human, Mouse, Rat.

Additional Details

NCBI/Uniprot data below describe general gene information for PGP9.5. It may not necessarily be applicable to this product.

NCBI GI #
21361091
NCBI GeneID
7345
NCBI Accession #
NP_004172.2
UniProt Primary Accession #
P09936
UniProt Secondary Accession #
Q4W5K6; Q71UM0
UniProt Related Accession #
P09936
GenBank Nucleotide #
NM_004181.4
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase isozyme L1
NCBI Official Synonym Full Names
ubiquitin C-terminal hydrolase L1
NCBI Official Symbol
UCHL1
NCBI Official Synonym Symbols
NDGOA; PARK5; PGP95; PGP9.5; Uch-L1; HEL-117; PGP 9.5; HEL-S-53
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase isozyme L1
UniProt Synonym Protein Names
Neuron cytoplasmic protein 9.5; PGP 9.5; PGP9.5; Ubiquitin thioesterase L1
Protein Family
Ubiquitin carboxyl-terminal hydrolase
UniProt Gene Name
UCHL1
UniProt Synonym Gene Names
UCH-L1; PGP9.5
UniProt Entry Name
UCHL1_HUMAN
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase isozyme L1

NCBI Summary for PGP9.5

The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease.[provided by RefSeq, Sep 2009]
Show more

UniProt Comments for PGP9.5

UCHL1: Ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. Also binds to free monoubiquitin and may prevent its degradation in lysosomes. The homodimer may have ATP-independent ubiquitin ligase activity. Monomer. Homodimer. Interacts with SNCA. Interacts with COPS5. Found in neuronal cell bodies and processes throughout the neocortex. Expressed in neurons and cells of the diffuse neuroendocrine system and their tumors. Weakly expressed in ovary. Down-regulated in brains from Parkinson disease and Alzheimer disease patients. Belongs to the peptidase C12 family.

Protein type: Cell development/differentiation; Ligase; EC 3.4.19.12; Protease; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 4p14

Cellular Component: cell soma; cytoplasm; cytosol; endoplasmic reticulum membrane; myelin sheath; nucleoplasm; plasma membrane

Molecular Function: alpha-2A adrenergic receptor binding; cysteine-type endopeptidase activity; ligase activity; omega peptidase activity; protein binding; ubiquitin binding; ubiquitin protein ligase binding; ubiquitin-specific protease activity

Biological Process: adult walking behavior; axon target recognition; axon transport of mitochondrion; cell proliferation; eating behavior; muscle fiber development; negative regulation of MAP kinase activity; neuromuscular process; proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination; regulation of macroautophagy; sensory perception of pain

Disease: Neurodegeneration With Optic Atrophy, Childhood-onset; Parkinson Disease 5, Autosomal Dominant
Show more

Research Articles on PGP9.5

1. High Ubiquitin C-terminal hydrolase-L1 increases cancer cell invasion by modulating hydrogen peroxide generated via NADPH oxidase 4.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-PGP9.5 antibody

 Reference Product  PubMed Publications
 SNCA antibody  >30 publications with PGP9.5 and SNCA
 CDKN2A antibody  >4 publications with PGP9.5 and CDKN2A
 TP53 antibody  >4 publications with PGP9.5 and TP53
 HSP90AA1 antibody  >2 publications with PGP9.5 and HSP90AA1
 COPS5 antibody  >1 publications with PGP9.5 and COPS5
 HSPA8 antibody  >1 publications with PGP9.5 and HSPA8

Pathways associated with anti-PGP9.5 antibody

 Products by Pathway  Pathway Diagram
 Alpha-synuclein Signaling Pathway antibodies  Alpha-synuclein Signaling Pathway Diagram
 Parkinson's Disease Pathway antibodies  Parkinson's Disease Pathway Diagram
 Parkinsons Disease Pathway antibodies  Parkinsons Disease Pathway Diagram
 Proteasome Degradation Pathway antibodies  Proteasome Degradation Pathway Diagram

Diseases associated with anti-PGP9.5 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >241 publications with PGP9.5 and Nervous System Diseases
 Brain Diseases Antibodies  >172 publications with PGP9.5 and Brain Diseases
 Movement Disorders Antibodies  >104 publications with PGP9.5 and Movement Disorders
 Inflammation Antibodies  >48 publications with PGP9.5 and Inflammation
 Disease Models, Animal Antibodies  >43 publications with PGP9.5 and Disease Models, Animal
 Peripheral Nervous System Diseases Antibodies  >36 publications with PGP9.5 and Peripheral Nervous System Diseases
 Cardiovascular Diseases Antibodies  >35 publications with PGP9.5 and Cardiovascular Diseases
 Necrosis Antibodies  >25 publications with PGP9.5 and Necrosis
 Nerve Degeneration Antibodies  >22 publications with PGP9.5 and Nerve Degeneration
 Brain Injuries Antibodies  >18 publications with PGP9.5 and Brain Injuries

Organs/Tissues associated with anti-PGP9.5 antibody

 Organ/Tissue Name  Pubmed Publications
 Nerve Antibodies  >218 publications with PGP9.5 and Nerve
 Brain Antibodies  >141 publications with PGP9.5 and Brain
 Skin Antibodies  >102 publications with PGP9.5 and Skin
 Lymph Antibodies  >65 publications with PGP9.5 and Lymph
 Muscle Antibodies  >64 publications with PGP9.5 and Muscle
 Bone Antibodies  >64 publications with PGP9.5 and Bone
 Lymph Node Antibodies  >63 publications with PGP9.5 and Lymph Node
 Vascular Antibodies  >60 publications with PGP9.5 and Vascular
 Lung Antibodies  >43 publications with PGP9.5 and Lung
 Bone Marrow Antibodies  >37 publications with PGP9.5 and Bone Marrow
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000