• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

KU70 Antibody – Polyclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178384

Description: Rabbit IgG polyclonal antibody for X-ray repair cross-complementing protein 6(XRCC6) detection. Tested with WB, IHC-P in Human.Background: XRCC6 (X-Ray Repair, Complementing Defective, In Chinese Hamster, 6), also called Ku70, G22P1 or TLAA, is a… More details

$210 / 0.01 mg +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
Ku70, Polyclonal Antibody
Full Product Name
Anti-Ku70 Antibody
Product Gene Name
anti-Ku70 antibody
Product Synonym Names
X-ray repair cross-complementing protein 6; 5''-deoxyribose-5-phosphate lyase Ku70; 5''-dRP lyase Ku70; 70 kDa subunit of Ku antigen; ATP dependent DNA helicase 2 subunit 1; ATP dependent DNA helicase II 70 kDa subunit; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; CTC box binding factor 75 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; CTCBF; DNA repair protein XRCC6; G22P1; Ku 70; Ku autoantigen 70kDa; Ku autoantigen p70 subunit; Ku autoantigen, 70kDa; Ku p70; Ku70; Ku70 DNA binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa; Kup70; Lupus Ku autoantigen protein p70; ML8; Thyroid autoantigen 70kD (Ku antigen); Thyroid autoantigen; Thyroid lupus autoantigen; Thyroid lupus autoantigen p70; Thyroid-lupus autoantigen; TLAA; X ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair cross-complementing protein 6; XRCC 6; XRCC6; XRCC6_HUMAN; X-ray repair complementing defective repair in Chinese hamster cells 6
Clonality
Polyclonal
Species Reactivity
Human
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purity/Purification
Immunogen Affinity Purified
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Molecular Weight
65,149 Da
OMIM
152690
3D Structure
ModBase 3D Structure for P12956
Immunogen
A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD), different from the related mouse sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Applications Tested/Suitable for anti-Ku70 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-Ku70 antibody
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml

Western Blot (WB) of anti-Ku70 antibody

Anti- Ku70 Picoband antibody, MBS178384, Western blotting
All lanes: Anti (MBS178384) at 0.5ug/ml
Lane 1: A549 Whole Cell Lysate at 40ug
Lane 2: HELA Whole Cell Lysate at 40ug
Lane 3: HEPG2 Whole Cell Lysate at 40ug
Lane 4: MCF-7 Whole Cell Lysate at 40ug
Predicted bind size: 70KD
Observed bind size: 70KD
Anti-KU70 Polyclonal Antibody – Cat# MBS178384

Immunohistochemistry (IHC) of anti-Ku70 antibody

Anti- Ku70 Picoband antibody, MBS178384, IHC(P)
IHC(P): Human Tonsil Tissue
Anti-KU70 Polyclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS178384

Product References and Citations for anti-Ku70 antibody

1. Baumann, P., West, S. C. DNA end-joining catalyzed by human cell-free extracts. Proc. Nat. Acad. Sci. 95: 14066- 14070, 1998. 2. Chan, J. Y. C., Lerman, M. I., Prabhakar, B. S., Isozaki, O., Santisteban, P., Kuppers, R. C., Oates, E. L., Notkins, A. L., Kohn, L. D. Cloning and characterization of a cDNA that encodes a 70-kDa novel human thyroid autoantigen. J. Biol. Chem. 264: 3651-3654, 1989.

Other Notes

Small volumes of anti-Ku70 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for Ku70 purchase

MBS178384 is an antibody targeting Ku70. Reactive in Human.

Additional Details

NCBI/Uniprot data below describe general gene information for Ku70. It may not necessarily be applicable to this product.

NCBI GI #
573014815
NCBI GeneID
2547
NCBI Accession #
NP_001275905.1
UniProt Primary Accession #
P12956
UniProt Secondary Accession #
Q6FG89; Q9UCQ2; Q9UCQ3; B1AHC8
UniProt Related Accession #
P12956
GenBank Nucleotide #
NM_001288976.1
NCBI Official Full Name
X-ray repair cross-complementing protein 6 isoform 1
NCBI Official Synonym Full Names
X-ray repair complementing defective repair in Chinese hamster cells 6
NCBI Official Symbol
XRCC6
NCBI Official Synonym Symbols
ML8; KU70; TLAA; CTC75; CTCBF; G22P1
UniProt Protein Name
X-ray repair cross-complementing protein 6
UniProt Synonym Protein Names
5'-deoxyribose-5-phosphate lyase Ku70; 5'-dRP lyase Ku70; 70 kDa subunit of Ku antigen; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; CTCBF; DNA repair protein XRCC6; Lupus Ku autoantigen protein p70; Ku70; Thyroid-lupus autoantigen; TLAA; X-ray repair complementing defective repair in Chinese hamster cells 6
Protein Family
ATP-dependent DNA helicase
UniProt Gene Name
XRCC6
UniProt Synonym Gene Names
G22P1; 5'-dRP lyase Ku70; CTC75; CTCBF; Ku70; TLAA
UniProt Entry Name
XRCC6_HUMAN
NCBI Protein Information
X-ray repair cross-complementing protein 6

NCBI Summary for Ku70

The p70/p80 autoantigen is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for Ku70

Ku70: a mini-chromosome maintenance protein, essential for the initiation of eukaryotic genome replication. Allows DNA to undergo a single round of replication per cell cycle. Required for the entry in S phase and for cell division.

Protein type: Helicase; EC 3.6.4.-; EC 4.2.99.-; DNA-binding; RNA-binding; Nuclear receptor co-regulator; DNA repair, damage

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: cytosol; membrane; nuclear chromosome, telomeric region; nuclear telomere cap complex; nucleoplasm; nucleus; transcription factor complex

Molecular Function: 5'-deoxyribose-5-phosphate lyase activity; ATP binding; ATP-dependent DNA helicase activity; damaged DNA binding; DNA binding; double-stranded DNA binding; double-stranded telomeric DNA binding; protein binding; protein C-terminus binding

Biological Process: DNA duplex unwinding; DNA ligation; DNA recombination; double-strand break repair via nonhomologous end joining; negative regulation of transcription, DNA-dependent; positive regulation of interferon type I production; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; protein heterotetramerization; regulation of smooth muscle cell proliferation; telomere maintenance; transcription, DNA-dependent
Show more

Research Articles on Ku70

1. retinoblastoma tumor suppressor protein variants disabled for the interaction with XRCC5 and XRCC6, including a cancer-associated variant, are unable to support canonical non-homologous end-joining despite being able to confer cell-cycle control

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-Ku70 antibody

 Products by Pathway  Pathway Diagram
 2-LTR Circle Formation Pathway antibodies  2-LTR Circle Formation Pathway Diagram
 BARD1 Signaling Events Pathway antibodies  BARD1 Signaling Events Pathway Diagram
 Coregulation Of Androgen Receptor Activity Pathway antibodies  Coregulation Of Androgen Receptor Activity Pathway Diagram
 Cytosolic Sensors Of Pathogen-associated DNA Pathway antibodies  Cytosolic Sensors Of Pathogen-associated DNA Pathway Diagram
 DNA Double-Strand Break Repair Pathway antibodies  DNA Double-Strand Break Repair Pathway Diagram
 DNA Repair Pathway antibodies  DNA Repair Pathway Diagram
 DNA-PK Complex Pathway antibodies  DNA-PK Complex Pathway Diagram
 DNA-PK Complex Pathway antibodies  DNA-PK Complex Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Early Phase Of HIV Life Cycle Pathway antibodies  Early Phase Of HIV Life Cycle Pathway Diagram

Diseases associated with anti-Ku70 antibody

 Disease Name  Pubmed Publications
 Carcinoma Antibodies  >15 publications with Ku70 and Carcinoma
 Adenocarcinoma Antibodies  >9 publications with Ku70 and Adenocarcinoma
 Breast Neoplasms Antibodies  >8 publications with Ku70 and Breast Neoplasms
 Chromosome Aberrations Antibodies  >5 publications with Ku70 and Chromosome Aberrations
 Carcinoma, Hepatocellular Antibodies  >5 publications with Ku70 and Carcinoma, Hepatocellular
 Liver Neoplasms Antibodies  >4 publications with Ku70 and Liver Neoplasms
 Leukemia Antibodies  >4 publications with Ku70 and Leukemia
 Lymphoma Antibodies  >4 publications with Ku70 and Lymphoma
 Liver Diseases Antibodies  >4 publications with Ku70 and Liver Diseases
 Lung Neoplasms Antibodies  >3 publications with Ku70 and Lung Neoplasms

Organs/Tissues associated with anti-Ku70 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >12 publications with Ku70 and Blood
 Liver Antibodies  >5 publications with Ku70 and Liver
 Lung Antibodies  >5 publications with Ku70 and Lung
 Kidney Antibodies  >4 publications with Ku70 and Kidney
 Brain Antibodies  >4 publications with Ku70 and Brain
 Ovary Antibodies  >3 publications with Ku70 and Ovary
 Prostate Antibodies  >3 publications with Ku70 and Prostate
 Bone Antibodies  >2 publications with Ku70 and Bone
 Bladder Antibodies  >2 publications with Ku70 and Bladder
 Bone Marrow Antibodies  >2 publications with Ku70 and Bone Marrow
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000