Rabbit Anti-MC3R Polyclonal Antibody – Cat# MBS178672

Western blot analysis of MC3 Receptor expression in mouse kidney extract (lane 1), and COLO320 whole cell lysates (lane 2). MC3 Receptor at 40KD was detected using rabbit anti- MC3 Receptor Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

MC3 Receptor (MC3R) Antibody – Rabbit Polyclonal

Name: MC3R Antibody; Polyclonal; Rabbit; Human/Mouse-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS178672
Price: 210 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS178672

Rabbit IgG polyclonal antibody for Melanocortin receptor 3(MC3R) detection.Background: Melanocortin receptor 3 is a protein that in humans is encoded by the MC3R gene. It is mapped to 20q13.2. This gene encodes a G-protein-coupled receptor for… More details

$210 / 0.01 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MC3 Receptor (MC3R), Polyclonal Antibody

Full Product Name

Anti-MC3 Receptor Antibody

Product Gene Name

anti-MC3R antibody

Product Synonym Names

BMIQ9; MC3; MC3 R; MC3-R; Mc3r; OB20; OQTL; P41968; Melanocortin receptor 3

Clonality

Polyclonal

Isotype

IgG

Host

Rabbit

Species Reactivity

Human, Mouse

Form/Format

Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purity/Purification

Immunogen affinity purified.

Preparation and Storage

Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Molecular Weight

36,043 Da

OMIM

L06155 Genomic DNA

3D Structure

ModBase 3D Structure for P41968

Notes

Tested Species: In-house tested species with positive results.
Other applications have not been tested.

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human MC3 Receptor (91-121aa NALETIMIAIVHSDYLTFEDQFIQHMDNIFD), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.

ISO Certification

Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.

Applications Tested/Suitable for anti-MC3R antibody

Western Blot (WB)

Application Notes for anti-MC3R antibody

Western Blot: 0.1-0.5ug/ml

Product References and Citations for anti-MC3R antibody

1. "Entrez Gene: MC3R melanocortin 3 receptor".
2. Gantz I, Konda Y, Tashiro T, Shimoto Y, Miwa H, Munzert G, Watson SJ, DelValle J, Yamada T (Apr 1993). "Molecular cloning of a novel melanocortin receptor". The Journal of Biological Chemistry. 268 (11): 8246-50.
3. Konda Y, Gantz I, DelValle J, Shimoto Y, Miwa H, Yamada T (May 1994). "Interaction of dual intracellular signaling pathways activated by the melanocortin-3 receptor". The Journal of Biological Chemistry. 269 (18): 13162-6.

Other Notes

Small volumes of anti-MC3R antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MC3R purchase

MBS178672 is an antibody targeting MC3R. Also known as Anti-MC3 Receptor Antibody. Reactive in Human, Mouse. Host: Rabbit.

Additional Details

NCBI/Uniprot data below describe general gene information for MC3R. It may not necessarily be applicable to this product.

NCBI GI #

170671732

NCBI GeneID

4159

NCBI Accession #

NP_063941.3

UniProt Primary Accession #

P41968

UniProt Secondary Accession #

Q4KN27; Q9H517

UniProt Related Accession #

P41968

GenBank Nucleotide #

NM_019888.3

NCBI Official Full Name

melanocortin receptor 3

NCBI Official Synonym Full Names

melanocortin 3 receptor

NCBI Official Symbol

MC3R

NCBI Official Synonym Symbols

MC3; OB20; OQTL; BMIQ9; MC3-R

UniProt Protein Name

Melanocortin receptor 3

Protein Family

Melanocortin receptor

UniProt Gene Name

MC3R

UniProt Synonym Gene Names

MC3-R

NCBI Protein Information

melanocortin receptor 3

NCBI Summary for MC3R

This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans. [provided by RefSeq, Jul 2008]

UniProt Comments for MC3R

MC3R: Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: melanocortin receptor activity; melanocyte stimulating hormone receptor activity; neuropeptide binding; protein binding

Biological Process: circadian regulation of gene expression; G-protein signaling, coupled to cyclic nucleotide second messenger; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of cAMP biosynthetic process

Disease: Body Mass Index Quantitative Trait Locus 9; Mycobacterium Tuberculosis, Susceptibility To

Research Articles on MC3R

1. There is no evidence of any association between MC3R variations and obesity.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-MC3R antibody

Reference Product	PubMed Publications
POMC antibody	>170 publications with MC3R and POMC
AGRP antibody	>71 publications with MC3R and AGRP
CRH antibody	>3 publications with MC3R and CRH
GNAS antibody	>1 publications with MC3R and GNAS
CRHR2 antibody	>1 publications with MC3R and CRHR2

Pathways associated with anti-MC3R antibody

Products by Pathway	Pathway Diagram
Circadian Rythm Related Genes Pathway antibodies	Circadian Rythm Related Genes Pathway Diagram
Class A/1 (Rhodopsin-like Receptors) Pathway antibodies	Class A/1 (Rhodopsin-like Receptors) Pathway Diagram
G Alpha (s) Signalling Events Pathway antibodies	G Alpha (s) Signalling Events Pathway Diagram
GPCR Downstream Signaling Pathway antibodies	GPCR Downstream Signaling Pathway Diagram
GPCR Ligand Binding Pathway antibodies	GPCR Ligand Binding Pathway Diagram
GPCRs, Class A Rhodopsin-like Pathway antibodies	GPCRs, Class A Rhodopsin-like Pathway Diagram
Neuroactive Ligand-receptor Interaction Pathway antibodies	Neuroactive Ligand-receptor Interaction Pathway Diagram
Neuroactive Ligand-receptor Interaction Pathway antibodies	Neuroactive Ligand-receptor Interaction Pathway Diagram
Peptide GPCRs Pathway antibodies	Peptide GPCRs Pathway Diagram
Peptide Ligand-binding Receptors Pathway antibodies	Peptide Ligand-binding Receptors Pathway Diagram

Diseases associated with anti-MC3R antibody

Disease Name	Pubmed Publications
Obesity Antibodies	>148 publications with MC3R and Obesity
Weight Loss Antibodies	>22 publications with MC3R and Weight Loss
Inflammation Antibodies	>22 publications with MC3R and Inflammation
Weight Gain Antibodies	>14 publications with MC3R and Weight Gain
Hypertension Antibodies	>14 publications with MC3R and Hypertension
Vascular Diseases Antibodies	>9 publications with MC3R and Vascular Diseases
Mental Disorders Antibodies	>9 publications with MC3R and Mental Disorders
Glucose Intolerance Antibodies	>6 publications with MC3R and Glucose Intolerance
Fatty Liver Antibodies	>4 publications with MC3R and Fatty Liver
Immune System Diseases Antibodies	>3 publications with MC3R and Immune System Diseases

Organs/Tissues associated with anti-MC3R antibody

Organ/Tissue Name	Pubmed Publications
Mixed Antibodies	>3 publications with MC3R and Mixed