Mouse Anti-ITGA3 Monoclonal Antibody – Cat# MBS570166

Figure 1: Immunohistochemistry on frozen section of human kidney

Integrin Alpha 3a (ITGA3) Antibody – Mouse Monoclonal

Name: ITGA3 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS570166
Price: 605 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS570166

Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins… More details

$605 / 0.1 mg +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Integrin alpha 3A (Itga3), Monoclonal Antibody

Full Product Name

Mouse anti Integrin alpha 3A

Product Gene Name

anti-Itga3 antibody

Clonality

Monoclonal

Isotype

IgG1

Clone Number

29A3

Host

Mouse

Species Reactivity

Human

Form/Format

Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.

Specificity

29A3 recognizes specifically the cytoplasmic domain of integrin subunit alpha3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.

Preparation and Storage

Store at 4 degree C, or in small aliquots at -20 degree C.

Molecular Weight

116,745 Da

Chromosome Location

Chromosome: 11; NC_000077.6 (95044482..95076714, complement). Location: 11 D; 11 59.01 cM

3D Structure

ModBase 3D Structure for Q62470

Source Note

29A3 is a Mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Reactivity Note

A broad species reactivity is expected because of the conserved nature of the epitope.

Product Categories/Family for anti-Itga3 antibody

Cell adhesion; Cancer; Cell adhesion

Applications Tested/Suitable for anti-Itga3 antibody

Immunocytochemistry (IHC), Immunohistochemistry (IHC) (frozen), Western Blot (WB)

Application Notes for anti-Itga3 antibody

29A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titRation; recommended range is 1:100 - 1:200 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:1000 for immunoblotting appliCations.

Product References and Citations for anti-Itga3 antibody

Delwel, G. O., de Melker, A. A., Hogervorst, F., Jaspars, L. H., Fles, D. L., Kuikman, I., Lindblom, A., Paulsson, M., Timpl, R., and Sonnenberg, A. (1994). Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms, Mol Biol Cell 5, 203-15. de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.

Other Notes

Small volumes of anti-Itga3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for Itga3 purchase

MBS570166 is an antibody targeting Itga3. Also known as Mouse anti Integrin alpha 3A. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for Itga3. It may not necessarily be applicable to this product.

NCBI GI #

8178480

NCBI GeneID

16400

NCBI Accession #

AAB20356.2

UniProt Primary Accession #

Q62470

UniProt Secondary Accession #

Q08441; Q08442; Q5SWA8; Q5SWB9; Q6P6I1

UniProt Related Accession #

Q62470

NCBI Official Full Name

integrin alpha 3A

NCBI Official Synonym Full Names

integrin alpha 3

NCBI Official Symbol

Itga3

NCBI Official Synonym Symbols

CD49C; GAPB3; AA407068

UniProt Protein Name

Integrin alpha-3

UniProt Synonym Protein Names

CD49 antigen-like family member C; Galactoprotein B3; GAPB3; VLA-3 subunit alpha

Protein Family

Integrin

UniProt Gene Name

Itga3

UniProt Synonym Gene Names

GAPB3

UniProt Entry Name

ITA3_MOUSE

NCBI Protein Information

integrin alpha-3; VLA-3 alpha 3; alpha3-integrin; galactoprotein B3; VLA-3 subunit alpha; VLA-3 receptor, alpha 3 subunit; CD49 antigen-like family member C

NCBI Summary for Itga3

This gene encodes a subunit of integrin family of cell surface proteins. The encoded protein undergoes post-translational processing to form a disulfide bond-linked dimer comprised of heavy and light chains. At the cell surface, the encoded protein non-covalently associates with the integrin beta-1 subunit to form a heterodimer that interacts with many extracellular matrix proteins including fibronectin and laminin. Mice lacking the encoded protein die during the first day after birth due to severe abnormalities in kidneys. Mice lacking the encoded protein specifically in the basal layer of epidermis display several skin defects and accelerated wound healing. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]

UniProt Comments for Itga3

ITGA3: an integral membrane protein that heterodimerizes with a beta chain, forming a receptor for many extracellular-matrix proteins including fibronectin, laminin, collagen, epiligrin and thrombospondin. Undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains that join with beta 1. Two alternatively spliced isoforms have been described.

Protein type: Cell adhesion; Receptor, misc.; Membrane protein, integral; Motility/polarity/chemotaxis

Cellular Component: filopodium membrane; focal adhesion; cell surface; basolateral plasma membrane; integral to membrane; excitatory synapse; growth cone; cell projection; membrane; perinuclear region of cytoplasm; plasma membrane; synapse; integrin complex; cell junction; receptor complex; external side of plasma membrane

Molecular Function: integrin binding; collagen binding; protein domain specific binding; protein binding; protease binding; protein heterodimerization activity; fibronectin binding; laminin binding; glycoprotein binding

Biological Process: integrin-mediated signaling pathway; skin development; regulation of transforming growth factor beta receptor signaling pathway; fusion of sperm to egg plasma membrane; negative regulation of Rho protein signal transduction; regulation of BMP signaling pathway; regulation of Wnt receptor signaling pathway; neuron migration; cell adhesion; memory; negative regulation of cell projection organization and biogenesis; lung development

Research Articles on Itga3

1. overexpression of mesangial integrin alpha1 and podocyte vimentin and integrin alpha3 may be important features of glomerular Alport disease

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-Itga3 antibody

Products by Pathway	Pathway Diagram
Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway antibodies	Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway Diagram
Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway antibodies	Arrhythmogenic Right Ventricular Cardiomyopathy (ARVC) Pathway Diagram
Basigin Interactions Pathway antibodies	Basigin Interactions Pathway Diagram
Cell Surface Interactions At The Vascular Wall Pathway antibodies	Cell Surface Interactions At The Vascular Wall Pathway Diagram
Dilated Cardiomyopathy Pathway antibodies	Dilated Cardiomyopathy Pathway Diagram
Dilated Cardiomyopathy Pathway antibodies	Dilated Cardiomyopathy Pathway Diagram
ECM-receptor Interaction Pathway antibodies	ECM-receptor Interaction Pathway Diagram
ECM-receptor Interaction Pathway antibodies	ECM-receptor Interaction Pathway Diagram
Focal Adhesion Pathway antibodies	Focal Adhesion Pathway Diagram
Focal Adhesion Pathway antibodies	Focal Adhesion Pathway Diagram

Diseases associated with anti-Itga3 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>14 publications with Itga3 and Neoplasms
Lung Neoplasms Antibodies	>4 publications with Itga3 and Lung Neoplasms
Lung Diseases Antibodies	>4 publications with Itga3 and Lung Diseases
Nervous System Malformations Antibodies	>2 publications with Itga3 and Nervous System Malformations
Nervous System Diseases Antibodies	>2 publications with Itga3 and Nervous System Diseases
Congenital Abnormalities Antibodies	>2 publications with Itga3 and Congenital Abnormalities
Breast Neoplasms Antibodies	>2 publications with Itga3 and Breast Neoplasms
Kidney Diseases Antibodies	>2 publications with Itga3 and Kidney Diseases
Neurobehavioral Manifestations Antibodies	>1 publications with Itga3 and Neurobehavioral Manifestations
Cell Transformation, Neoplastic Antibodies	>1 publications with Itga3 and Cell Transformation, Neoplastic

Organs/Tissues associated with anti-Itga3 antibody

Organ/Tissue Name	Pubmed Publications
Lung Antibodies	>5 publications with Itga3 and Lung
Skin Antibodies	>4 publications with Itga3 and Skin
Brain Antibodies	>3 publications with Itga3 and Brain
Embryonic Tissue Antibodies	>3 publications with Itga3 and Embryonic Tissue
Kidney Antibodies	>2 publications with Itga3 and Kidney
Inner Ear Antibodies	>1 publications with Itga3 and Inner Ear
Bone Marrow Antibodies	>1 publications with Itga3 and Bone Marrow
Salivary Gland Antibodies	>1 publications with Itga3 and Salivary Gland
Ovary Antibodies	>1 publications with Itga3 and Ovary