• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ARNT Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6140676

MBS6140676 is an antibody targeting ARNT. Also known as ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta,… More details

$1155 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ARNT, Monoclonal Antibody
Full Product Name
ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (Biotin)
Product Gene Name
anti-ARNT antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D10
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ARNT.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
86,366 Da
Immunogen
Partial recombinant corresponding to aa1-110 from human ARNT (AAH60838) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYIT
Conjugate
Biotin

Product Categories/Family for anti-ARNT antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-ARNT antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-ARNT antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ARNT antibody

Western Blot detection against Immunogen (37.73kD).
Mouse Anti-ARNT Monoclonal Antibody – Cat# MBS6140676

Western Blot (WB) of anti-ARNT antibody

ARNT monoclonal antibody Western Blot analysis of ARNT expression in Hela NE.
Mouse Anti-ARNT Monoclonal Antibody, Western Blot (WB) – Cat# MBS6140676

Immunohistochemistry (IHC) of anti-ARNT antibody

Immunoperoxidase of monoclonal antibody to ARNT on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml].
Mouse Anti-ARNT Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6140676

Immunofluorescence (IF) of anti-ARNT antibody

Immunofluorescence of monoclonal antibody to ARNT on HeLa cell. [antibody concentration 10ug/ml].
Mouse Anti-ARNT Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6140676

Testing Data of anti-ARNT antibody

Detection limit for recombinant GST tagged ARNT is ~0.03ng/ml as a capture antibod
Mouse Anti-ARNT Monoclonal Antibody, Testing Data – Cat# MBS6140676

Western Blot (WB) of anti-ARNT antibody

Western Blot analysis of ARNT expression in transfected 293T cell line by ARNT monoclonal antibody. Lane 1: ARNT transfected lysate (86.6kD). Lane 2: Non-transfected lysate.
Mouse Anti-ARNT Monoclonal Antibody, Western Blot (WB) – Cat# MBS6140676

Western Blot (WB) of anti-ARNT antibody

Western blot analysis of ARNT over-expressed 293 cell line, cotransfected with ARNT Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ARNT monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-ARNT Monoclonal Antibody, Western Blot (WB) – Cat# MBS6140676

Other Notes

Small volumes of anti-ARNT antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ARNT. It may not necessarily be applicable to this product.

NCBI GI #
38173805
NCBI GeneID
405
NCBI Accession #
BC060838
NCBI Related Accession #
AAH60838
UniProt Secondary Accession #
Q59ED4; Q5QP39; Q8NDC7; B2R9H1; C4AMA1; F8WAP6
UniProt Related Accession #
P27540
NCBI Official Full Name
Homo sapiens aryl hydrocarbon receptor nuclear translocator, mRNA
NCBI Official Synonym Full Names
aryl hydrocarbon receptor nuclear translocator
NCBI Official Symbol
ARNT
NCBI Official Synonym Symbols
HIF1B; TANGO; bHLHe2; HIF1BETA; HIF-1beta; HIF1-beta; HIF-1-beta
Protein Family
Aryl hydrocarbon receptor nuclear translocator
NCBI Protein Information
aryl hydrocarbon receptor nuclear translocator; class E basic helix-loop-helix protein 2; dioxin receptor, nuclear translocator; hypoxia-inducible factor 1, beta subunit

NCBI Summary for ARNT

This gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2013]
Show more

Research Articles on ARNT

1. knockdown of ARNT in cancer cells reduced the proliferation rate and the transformation ability of those cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ARNT antibody

 Reference Product  PubMed Publications
 AHR antibody  >642 publications with ARNT and AHR
 HIF1A antibody  >293 publications with ARNT and HIF1A
 SP1 antibody  >22 publications with ARNT and SP1
 SIM2 antibody  >14 publications with ARNT and SIM2
 EPAS1 antibody  >11 publications with ARNT and EPAS1
 NCOA1 antibody  >10 publications with ARNT and NCOA1
 AKT1 antibody  >4 publications with ARNT and AKT1
 EP300 antibody  >3 publications with ARNT and EP300
 HEY2 antibody  >1 publications with ARNT and HEY2
 LDHA antibody  >1 publications with ARNT and LDHA

Pathways associated with anti-ARNT antibody

 Products by Pathway  Pathway Diagram
 AhR Pathway antibodies  AhR Pathway Diagram
 Angiogenesis Pathway antibodies  Angiogenesis Pathway Diagram
 Cellular Response To Hypoxia Pathway antibodies  Cellular Response To Hypoxia Pathway Diagram
 Cellular Responses To Stress Pathway antibodies  Cellular Responses To Stress Pathway Diagram
 Chemical Carcinogenesis Pathway antibodies  Chemical Carcinogenesis Pathway Diagram
 Chemical Carcinogenesis Pathway antibodies  Chemical Carcinogenesis Pathway Diagram
 HIF-1 Signaling Pathway antibodies  HIF-1 Signaling Pathway Diagram
 HIF-1-alpha Transcription Factor Network Pathway antibodies  HIF-1-alpha Transcription Factor Network Pathway Diagram
 HIF-2-alpha Transcription Factor Network Pathway antibodies  HIF-2-alpha Transcription Factor Network Pathway Diagram
 Hypoxic And Oxygen Homeostasis Regulation Of HIF-1-alpha Pathway antibodies  Hypoxic And Oxygen Homeostasis Regulation Of HIF-1-alpha Pathway Diagram

Diseases associated with anti-ARNT antibody

 Disease Name  Pubmed Publications
 Liver Diseases Antibodies  >95 publications with ARNT and Liver Diseases
 Liver Neoplasms Antibodies  >89 publications with ARNT and Liver Neoplasms
 Cardiovascular Diseases Antibodies  >63 publications with ARNT and Cardiovascular Diseases
 Nervous System Diseases Antibodies  >59 publications with ARNT and Nervous System Diseases
 Carcinoma, Hepatocellular Antibodies  >55 publications with ARNT and Carcinoma, Hepatocellular
 Neoplasms, Experimental Antibodies  >45 publications with ARNT and Neoplasms, Experimental
 Breast Neoplasms Antibodies  >43 publications with ARNT and Breast Neoplasms
 Inflammation Antibodies  >33 publications with ARNT and Inflammation
 Necrosis Antibodies  >29 publications with ARNT and Necrosis
 Lung Neoplasms Antibodies  >20 publications with ARNT and Lung Neoplasms

Organs/Tissues associated with anti-ARNT antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >256 publications with ARNT and Liver
 Brain Antibodies  >224 publications with ARNT and Brain
 Blood Antibodies  >174 publications with ARNT and Blood
 Vascular Antibodies  >167 publications with ARNT and Vascular
 Muscle Antibodies  >148 publications with ARNT and Muscle
 Heart Antibodies  >85 publications with ARNT and Heart
 Lung Antibodies  >77 publications with ARNT and Lung
 Kidney Antibodies  >66 publications with ARNT and Kidney
 Embryonic Tissue Antibodies  >62 publications with ARNT and Embryonic Tissue
 Ovary Antibodies  >39 publications with ARNT and Ovary
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000