• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

KBTBD10 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6142561

KBTBD10 is required for pseudopod elongation in transformed cells. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
KBTBD10, Monoclonal Antibody
Full Product Name
KBTBD10 (KRP1, Kelch Repeat and BTB Domain-containing Protein 10, Kel-like Protein 23, Kelch-related Protein 1, Sarcosin) (Biotin)
Product Gene Name
anti-KBTBD10 antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1H3
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human KBTBD10.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
607701
3D Structure
ModBase 3D Structure for O60662
Immunogen
Partial recombinant corresponding to aa205-304 from KBTBD10 (NP_006054) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGMFVKD
Conjugate
Biotin

Product Categories/Family for anti-KBTBD10 antibody

Antibodies; Proteins
Applications Tested/Suitable for anti-KBTBD10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-KBTBD10 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-KBTBD10 antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-KBTBD10 Monoclonal Antibody – Cat# MBS6142561

Western Blot (WB) of anti-KBTBD10 antibody

Western Blot analysis of KBTBD10 expression in transfected 293T cell line by KBTBD10 monoclonal antibody. Lane 1: KBTBD10 transfected lysate (Predicted MW: 68kD). Lane 2: Non-transfected lysate.
Mouse Anti-KBTBD10 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6142561

Testing Data of anti-KBTBD10 antibody

Detection limit for recombinant GST tagged KBTBD10 is 0.03ng/ml as a capture antibody.
Mouse Anti-KBTBD10 Monoclonal Antibody, Testing Data – Cat# MBS6142561

Other Notes

Small volumes of anti-KBTBD10 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for KBTBD10 purchase

MBS6142561 is an antibody targeting KBTBD10. Also known as KBTBD10 (KRP1, Kelch Repeat and BTB Domain-containing Protein 10, Kel-like Protein 23, Kelch-related Protein 1, Sarcosin) (Biotin). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for KBTBD10. It may not necessarily be applicable to this product.

NCBI GI #
1519473523
NCBI GeneID
10324
NCBI Accession #
NM_006063.3
UniProt Primary Accession #
O60662
UniProt Related Accession #
O60662
GenBank Nucleotide #
NM_006063
NCBI Official Full Name
Homo sapiens kelch like family member 41 (KLHL41), mRNA
NCBI Official Synonym Full Names
kelch like family member 41
NCBI Official Symbol
KLHL41
NCBI Official Synonym Symbols
Krp1; KBTBD10; SARCOSIN
UniProt Protein Name
Kelch-like protein 41
UniProt Synonym Protein Names
Kel-like protein 23; Kelch repeat and BTB domain-containing protein 10; Kelch-related protein 1; Sarcosin
UniProt Gene Name
KLHL41
UniProt Synonym Gene Names
KBTBD10; KRP1
UniProt Entry Name
KLH41_HUMAN
NCBI Protein Information
kelch-like protein 41

NCBI Summary for KBTBD10

This gene is a member of the kelch-like family. The encoded protein contains a BACK domain, a BTB/POZ domain, and 5 Kelch repeats. This protein is thought to function in skeletal muscle development and maintenance. Mutations in this gene have been associated with nemaline myopathy (NM), a rare congenital muscle disorder. [provided by RefSeq, Mar 2015]
Show more

UniProt Comments for KBTBD10

KBTBD10: Required for pseudopod elongation in transformed cells. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Contractile; Cell adhesion; Ubiquitin conjugating system; Cytoskeletal

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: ruffle; endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; cytoskeleton; cytoplasm; plasma membrane; M band; pseudopodium; nucleus

Molecular Function: protein binding

Biological Process: myofibril assembly; striated muscle contraction; regulation of myoblast differentiation; protein ubiquitination; regulation of lateral pseudopodium formation

Disease: Nemaline Myopathy 9
Show more

Research Articles on KBTBD10

1. Mutations in KLHL41 showed phenotype-genotype correlation: Frameshift mutations resulted in severe phenotypes with neonatal death, whereas missense changes resulted in impaired motor function with survival into late childhood and/or early adulthood.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000