• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ZHX3 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6145226

MBS6145226 is an antibody targeting ZHX3. Also known as ZHX3 (Zinc Fingers and Homeoboxes Protein 3, Zinc Finger and Homeodomain Protein 3, KIAA0395, Triple Homeobox Protein 1, TIX1) (Biotin). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ZHX3, Monoclonal Antibody
Full Product Name
ZHX3 (Zinc Fingers and Homeoboxes Protein 3, Zinc Finger and Homeodomain Protein 3, KIAA0395, Triple Homeobox Protein 1, TIX1) (Biotin)
Product Gene Name
anti-ZHX3 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D9
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ZHX3.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
609598
3D Structure
ModBase 3D Structure for Q9H4I2
Immunogen
Partial recombinant corresponding to aa863-955 from ZHX3 (NP_055850) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSEDQGPGTGELTAVHKGMGDTYSEVSENSESWEPRVPEASSEPFDTSSPQAGRQLET*
Conjugate
Biotin

Product Categories/Family for anti-ZHX3 antibody

Antibodies; Transcription Factors; Homeobox (HOX)
Applications Tested/Suitable for anti-ZHX3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-ZHX3 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ZHX3 antibody

Western Blot detection against Immunogen (36.34kD).
Mouse Anti-ZHX3 Monoclonal Antibody – Cat# MBS6145226

Immunohistochemistry (IHC) of anti-ZHX3 antibody

Immunoperoxidase of monoclonal antibody to ZHX3 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3ug/ml]
Mouse Anti-ZHX3 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6145226

Testing Data of anti-ZHX3 antibody

Detection limit for recombinant GST tagged ZHX3 is 1ng/ml as a capture antibody.
Mouse Anti-ZHX3 Monoclonal Antibody, Testing Data – Cat# MBS6145226

Other Notes

Small volumes of anti-ZHX3 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ZHX3. It may not necessarily be applicable to this product.

NCBI GI #
1677501188
NCBI GeneID
23051
NCBI Accession #
NM_015035.4
UniProt Primary Accession #
Q9H4I2
UniProt Related Accession #
Q9H4I2
GenBank Nucleotide #
NM_015035
NCBI Official Full Name
Homo sapiens zinc fingers and homeoboxes 3 (ZHX3), mRNA
NCBI Official Synonym Full Names
zinc fingers and homeoboxes 3
NCBI Official Symbol
ZHX3
NCBI Official Synonym Symbols
TIX1
UniProt Protein Name
Zinc fingers and homeoboxes protein 3
UniProt Synonym Protein Names
Triple homeobox protein 1; Zinc finger and homeodomain protein 3
Protein Family
Zinc fingers and homeoboxes protein
UniProt Gene Name
ZHX3
UniProt Synonym Gene Names
KIAA0395; TIX1
UniProt Entry Name
ZHX3_HUMAN
NCBI Protein Information
zinc fingers and homeoboxes protein 3

NCBI Summary for ZHX3

This gene encodes a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for ZHX3

ZHX3: Acts as a transcriptional repressor. Involved in the early stages of mesenchymal stem cell (MSC) osteogenic differentiation. Is a regulator of podocyte gene expression during primary glomerula disease. Binds to promoter DNA. Belongs to the ZHX family.

Protein type: C2H2-type zinc finger protein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 20q12

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; protein homodimerization activity; DNA binding; protein heterodimerization activity; metal ion binding; transcription factor activity; transcription corepressor activity

Biological Process: positive regulation of osteoblast differentiation; transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; cell differentiation
Show more

Research Articles on ZHX3

1. ZHX3 expression in renal cell carcinoma

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000