• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

AP2S1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6145921

Adapter-related protein complex 2 sigma-1 subunit (AP2S1, AP17) is the component of the adaptor complexes which links clathrin to receptors in coated vesicles.It is the smallest polypeptide chain component of AP-2, a heterotetramer composed of two large… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
AP2S1, Monoclonal Antibody
Full Product Name
AP2S1 (Adaptor-related Protein Complex 2 sigma 1 Subunit, AP2 Complex Subunit sigma 1, AP-2 Complex Subunit sigma 1, AP 17, AP17, AP17 delta, Clathrin Assembly Protein 2 Small Chain, Clathrin-associated/assembly/adaptor Protein Small 2, CLAPS2, Clathrin C
Product Gene Name
anti-AP2S1 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E4
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human AP2S1.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
12,417 Da
Immunogen
Full length recombinant corresponding to aa1-142 from human AP2S1 (AAH06337) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Conjugate
FITC

Product Categories/Family for anti-AP2S1 antibody

Antibodies; Adapter Proteins
Applications Tested/Suitable for anti-AP2S1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-AP2S1 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-AP2S1 antibody

Western Blot detection against Immunogen (41.36kD).
Mouse Anti-AP2S1 Monoclonal Antibody – Cat# MBS6145921

Western Blot (WB) of anti-AP2S1 antibody

Western Blot analysis of AP2S1 expression in transfected 293T cell line by AP2S1 monoclonal antibody. Lane 1: AP2S1 transfected lysate (17kD). Lane 2: Non-transfected lysate.
Mouse Anti-AP2S1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6145921

Western Blot (WB) of anti-AP2S1 antibody

Western blot analysis of AP2S1 over-expressed 293 cell line, cotransfected with AP2S1 Validated Chimera RNAi ((Lane 2) or non-transfected control (Lane 1). Blot probed with AP2S1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-AP2S1 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6145921

Other Notes

Small volumes of anti-AP2S1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for AP2S1 purchase

MBS6145921 is an antibody targeting AP2S1. Also known as AP2S1 (Adaptor-related Protein Complex 2 sigma 1 Subunit, AP2 Complex Subunit sigma 1, AP-2 Complex Subunit sigma 1, AP 17, AP17, AP17 delta, Clathrin Assembly Protein 2 Small Chain, Clathrin-associated/assembly/adaptor Protein Small 2, CLAPS2, Clathrin C. Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for AP2S1. It may not necessarily be applicable to this product.

NCBI GI #
39645040
NCBI GeneID
1175
NCBI Accession #
BC006337
NCBI Related Accession #
AAH06337
UniProt Secondary Accession #
O75977; Q6PK67; B2R4Z4
UniProt Related Accession #
P53680
NCBI Official Full Name
Homo sapiens adaptor-related protein complex 2, sigma 1 subunit, mRNA
NCBI Official Synonym Full Names
adaptor related protein complex 2 sigma 1 subunit
NCBI Official Symbol
AP2S1
NCBI Official Synonym Symbols
AP17; FBH3; HHC3; FBHOk; CLAPS2
Protein Family
AP-2 complex
NCBI Protein Information
AP-2 complex subunit sigma

NCBI Summary for AP2S1

One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Show more

Research Articles on AP2S1

1. our studies demonstrate AP2sigma2 mutations to result in a more severe FHH phenotype with genotype-phenotype correlations, and a dominant-negative mechanism of action with mutational bias at the Arg15 residue.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-AP2S1 antibody

 Products by Pathway  Pathway Diagram
 Adaptive Immune System Pathway antibodies  Adaptive Immune System Pathway Diagram
 Axon Guidance Pathway antibodies  Axon Guidance Pathway Diagram
 Developmental Biology Pathway antibodies  Developmental Biology Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 EGFR Downregulation Pathway antibodies  EGFR Downregulation Pathway Diagram
 Endocrine And Other Factor-regulated Calcium Reabsorption Pathway antibodies  Endocrine And Other Factor-regulated Calcium Reabsorption Pathway Diagram
 Endocrine And Other Factor-regulated Calcium Reabsorption Pathway antibodies  Endocrine And Other Factor-regulated Calcium Reabsorption Pathway Diagram
 Endocytosis Pathway antibodies  Endocytosis Pathway Diagram
 Endocytosis Pathway antibodies  Endocytosis Pathway Diagram
 Glutamate Binding, Activation Of AMPA Receptors And Synaptic Plasticity Pathway antibodies  Glutamate Binding, Activation Of AMPA Receptors And Synaptic Plasticity Pathway Diagram

Diseases associated with anti-AP2S1 antibody

 Disease Name  Pubmed Publications
 Familial benign hypercalcemia, type 3 Antibodies  >1 publications with AP2S1 and Familial benign hypercalcemia, type 3

Organs/Tissues associated with anti-AP2S1 antibody

 Organ/Tissue Name  Pubmed Publications
 Nerve Antibodies  >5 publications with AP2S1 and Nerve
 Brain Antibodies  >3 publications with AP2S1 and Brain
 Kidney Antibodies  >2 publications with AP2S1 and Kidney
 Blood Antibodies  >1 publications with AP2S1 and Blood
 Bone Antibodies  >1 publications with AP2S1 and Bone
 Liver Antibodies  >1 publications with AP2S1 and Liver
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000