Mouse Anti-ARPC5 Monoclonal Antibody – Cat# MBS6145984

Western Blot detection against Immunogen (36.23kD).

ARPC5 Antibody – Mouse Monoclonal

Name: ARPC5 Antibody; Monoclonal; Mouse; Human/Mouse-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6145984
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6145984

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ARPC5, Monoclonal Antibody

Full Product Name

ARPC5 (Actin-related Protein 2/3 Complex Subunit 5, Arp2/3 Complex 16kD Subunit 2, p16-ARC, ARC16) (FITC)

Product Gene Name

anti-ARPC5 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2D10

Host

Mouse

Species Reactivity

Human, Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human ARPC5.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

604227

3D Structure

ModBase 3D Structure for O15511

Immunogen

Partial recombinant corresponding to aa3-94 from ARPC5 (NP_005708) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

KNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKA

Conjugate

FITC

Product Categories/Family for anti-ARPC5 antibody

Antibodies; Actin Related Proteins

Applications Tested/Suitable for anti-ARPC5 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-ARPC5 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-ARPC5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ARPC5 purchase

MBS6145984 is an antibody targeting ARPC5. Also known as ARPC5 (Actin-related Protein 2/3 Complex Subunit 5, Arp2/3 Complex 16kD Subunit 2, p16-ARC, ARC16) (FITC). Reactive in Human, Mouse. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ARPC5. It may not necessarily be applicable to this product.

NCBI GI #

1519243868

NCBI GeneID

10092

NCBI Accession #

NM_005717.4

UniProt Primary Accession #

O15511

UniProt Related Accession #

O15511

GenBank Nucleotide #

NM_005717

NCBI Official Full Name

Homo sapiens actin related protein 2/3 complex subunit 5 (ARPC5), transcript variant 1, mRNA

NCBI Official Synonym Full Names

actin related protein 2/3 complex subunit 5

NCBI Official Symbol

ARPC5

NCBI Official Synonym Symbols

ARC16; p16-Arc; dJ127C7.3

UniProt Protein Name

Actin-related protein 2/3 complex subunit 5

UniProt Synonym Protein Names

Arp2/3 complex 16 kDa subunit; p16-ARC

Protein Family

Actin-related protein 2/3 complex

UniProt Gene Name

ARPC5

UniProt Synonym Gene Names

ARC16; p16-ARC

UniProt Entry Name

ARPC5_HUMAN

NCBI Protein Information

actin-related protein 2/3 complex subunit 5

NCBI Summary for ARPC5

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

UniProt Comments for ARPC5

ARPC5: Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Belongs to the ARPC5 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 1q25.3

Cellular Component: Arp2/3 protein complex; focal adhesion; cell projection; cytoplasm; cytosol; actin cytoskeleton

Molecular Function: actin filament binding; protein binding; structural constituent of cytoskeleton

Biological Process: axon guidance; ephrin receptor signaling pathway; innate immune response; actin cytoskeleton organization and biogenesis; cell motility

Research Articles on ARPC5

1. Quantitative PCR demonstrated that ARPC5 was significantly increased in MM patients. GSEA results indicated that ARPC5 might affect cellular growth of myeloma cells through mammalian target of rapamycin (mTOR)C1 signaling pathway.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.