• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

GNG5 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6147425

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
GNG5, Monoclonal Antibody
Full Product Name
GNG5 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-5, GNGT5, FLJ92393) (FITC)
Product Gene Name
anti-GNG5 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human GNG5.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
7,318 Da
Immunogen
Full length recombinant corresponding to aa1-68 from human GNG5 (AAH03563) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL
Conjugate
FITC

Product Categories/Family for anti-GNG5 antibody

Antibodies; G Proteins
Applications Tested/Suitable for anti-GNG5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-GNG5 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-GNG5 antibody

Western Blot detection against Immunogen (33.22kD).
Mouse Anti-GNG5 Monoclonal Antibody – Cat# MBS6147425

Testing Data of anti-GNG5 antibody

Detection limit for recombinant GST tagged GNG5 is 1ng/ml as a capture antibody.
Mouse Anti-GNG5 Monoclonal Antibody, Testing Data – Cat# MBS6147425

Other Notes

Small volumes of anti-GNG5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for GNG5 purchase

MBS6147425 is an antibody targeting GNG5. Also known as GNG5 (Guanine Nucleotide-binding Protein G(I)/G(S)/G(O) Subunit gamma-5, GNGT5, FLJ92393) (FITC). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for GNG5. It may not necessarily be applicable to this product.

NCBI GI #
13097716
NCBI GeneID
2787
NCBI Accession #
BC003563
NCBI Related Accession #
AAH03563
UniProt Secondary Accession #
P30670; Q5VX54; Q61015; B2R5A0
UniProt Related Accession #
P63218
NCBI Official Full Name
Homo sapiens guanine nucleotide binding protein (G protein), gamma 5, mRNA
NCBI Official Synonym Full Names
G protein subunit gamma 5
NCBI Official Symbol
GNG5
NCBI Protein Information
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5

NCBI Summary for GNG5

G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules (Gilman, 1987 [PubMed 3113327]; summary by Ahmad et al., 1995) [PubMed 7606925].[supplied by OMIM, Nov 2010]
Show more

Research Articles on GNG5

1. Observational study of gene-disease association. (HuGE Navigator)

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-GNG5 antibody

 Products by Pathway  Pathway Diagram
 ADP Signalling Through P2Y Purinoceptor 1 Pathway antibodies  ADP Signalling Through P2Y Purinoceptor 1 Pathway Diagram
 ADP Signalling Through P2Y Purinoceptor 12 Pathway antibodies  ADP Signalling Through P2Y Purinoceptor 12 Pathway Diagram
 Activation Of G Protein Gated Potassium Channels Pathway antibodies  Activation Of G Protein Gated Potassium Channels Pathway Diagram
 Activation Of GABAB Receptors Pathway antibodies  Activation Of GABAB Receptors Pathway Diagram
 Activation Of Kainate Receptors Upon Glutamate Binding Pathway antibodies  Activation Of Kainate Receptors Upon Glutamate Binding Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Aquaporin-mediated Transport Pathway antibodies  Aquaporin-mediated Transport Pathway Diagram
 Calcium Regulation In The Cardiac Cell Pathway antibodies  Calcium Regulation In The Cardiac Cell Pathway Diagram
 Chemokine Signaling Pathway antibodies  Chemokine Signaling Pathway Diagram

Diseases associated with anti-GNG5 antibody

 Disease Name  Pubmed Publications
 Carcinoma Antibodies  >1 publications with GNG5 and Carcinoma
 Neoplasms Antibodies  >1 publications with GNG5 and Neoplasms
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000