• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

HIST1H3D Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6147588

MBS6147588 is an antibody targeting HIST1H3D. Also known as HIST1H3D (Histone Cluster 1, Histone H3.1, H3d, H3/b, H3FB) (FITC). Reactive in Human, Mouse. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
HIST1H3D, Monoclonal Antibody
Full Product Name
HIST1H3D (Histone Cluster 1, Histone H3.1, H3d, H3/b, H3FB) (FITC)
Product Gene Name
anti-HIST1H3D antibody
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
1D8
Host
Mouse
Species Reactivity
Human, Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human HIST1H3D. Species Crossreactivity: mouse.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
602810
3D Structure
ModBase 3D Structure for P68431
Immunogen
Partial recombinant corresponding to aa1-61 from HIST1H3D (NP_003521) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
Conjugate
FITC

Product Categories/Family for anti-HIST1H3D antibody

Antibodies; Histones
Applications Tested/Suitable for anti-HIST1H3D antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-HIST1H3D antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Immunofluorescence (IF) of anti-HIST1H3D antibody

Immunofluorescence of monoclonal antibody to HIST1H3D on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-HIST1H3D Monoclonal Antibody – Cat# MBS6147588

Immunohistochemistry (IHC) of anti-HIST1H3D antibody

Immunoperoxidase of monoclonal antibody to HIST1H3D on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3ug/ml]
Mouse Anti-HIST1H3D Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6147588

Western Blot (WB) of anti-HIST1H3D antibody

HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in NIH/3T3
Mouse Anti-HIST1H3D Monoclonal Antibody, Western Blot (WB) – Cat# MBS6147588

Western Blot (WB) of anti-HIST1H3D antibody

HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in Raw 264.7
Mouse Anti-HIST1H3D Monoclonal Antibody, Western Blot (WB) – Cat# MBS6147588

Western Blot (WB) of anti-HIST1H3D antibody

HIST1H3D monoclonal antibody Western Blot analysis of HIST1H3D expression in Hela NE
Mouse Anti-HIST1H3D Monoclonal Antibody, Western Blot (WB) – Cat# MBS6147588

Product References and Citations for anti-HIST1H3D antibody

1. Protective Effect of Caffeic Acid on Paclitaxel Induced Anti-Proliferation and Apoptosis of Lung Cancer Cells Involves NF-?eB Pathway. Lin CL, Chen RF, Chen YF, Chu YC, Wang HM, Chou HL, Chang WC, Fong Y, Chang WT, Wu CY, Chiu CC.Int. J. Mol. Sci. 2012, 13, 6236-6245.

Other Notes

Small volumes of anti-HIST1H3D antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for HIST1H3D. It may not necessarily be applicable to this product.

NCBI GI #
21071021
NCBI Accession #
NP_003521
UniProt Primary Accession #
P68431
GenBank Nucleotide #
NM_003530
NCBI Official Full Name
histone H3.1
UniProt Protein Name
Histone H3.1
UniProt Synonym Protein Names
Histone H3/a; Histone H3/b; Histone H3/c; Histone H3/d; Histone H3/f; Histone H3/h; Histone H3/i; Histone H3/j; Histone H3/k; Histone H3/l
UniProt Gene Name
HIST1H3A
UniProt Synonym Gene Names
H3FA
UniProt Entry Name
H31_HUMAN

UniProt Comments for HIST1H3D

H3: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Belongs to the histone H3 family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 6p22.2

Cellular Component: nucleoplasm; nuclear chromosome; protein complex; membrane; extracellular region; nucleosome; nucleus

Molecular Function: protein binding; DNA binding; histone binding; protein heterodimerization activity

Biological Process: chromatin silencing at rDNA; nucleosome assembly; establishment and/or maintenance of chromatin architecture; negative regulation of gene expression, epigenetic; protein heterotetramerization; gene expression; blood coagulation; regulation of gene expression, epigenetic; DNA replication-dependent nucleosome assembly; DNA methylation on cytosine
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-HIST1H3D antibody

 Products by Pathway  Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Alcoholism Pathway antibodies  Alcoholism Pathway Diagram
 Amyloids Pathway antibodies  Amyloids Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Factors Involved In Megakaryocyte Development And Platelet Production Pathway antibodies  Factors Involved In Megakaryocyte Development And Platelet Production Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Hemostasis Pathway antibodies  Hemostasis Pathway Diagram
 Meiosis Pathway antibodies  Meiosis Pathway Diagram
 Meiotic Recombination Pathway antibodies  Meiotic Recombination Pathway Diagram
 RNA Polymerase I Chain Elongation Pathway antibodies  RNA Polymerase I Chain Elongation Pathway Diagram

Diseases associated with anti-HIST1H3D antibody

 Disease Name  Pubmed Publications
 Disease Models, Animal Antibodies  >1 publications with HIST1H3D and Disease Models, Animal
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000