• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RPL4 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6149432

MBS6149432 is an antibody targeting RPL4. Also known as RPL4 (60S Ribosomal Protein L4, 60S Ribosomal Protein L1, RPL1, HRPL4 Ribosomal Protein L4) (FITC). Reactive in Human, Mouse, Rat. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RPL4, Monoclonal Antibody
Full Product Name
RPL4 (60S Ribosomal Protein L4, 60S Ribosomal Protein L1, RPL1, HRPL4 Ribosomal Protein L4) (FITC)
Product Gene Name
anti-RPL4 antibody
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A3
Host
Mouse
Species Reactivity
Human, Mouse, Rat
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human RPL4. Species Crossreactivity: mouse and rat.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
47,697 Da
OMIM
180479
3D Structure
ModBase 3D Structure for P36578
Immunogen
Partial recombinant corresponding to aa251-351, from human RPL4 (NP_000959) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR
Conjugate
FITC

Product Categories/Family for anti-RPL4 antibody

Antibodies; Ribosomal Proteins
Applications Tested/Suitable for anti-RPL4 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-RPL4 antibody
IF: 10ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-RPL4 antibody

RPL4 monoclonal antibody. Western Blot analysis of RPL4 expression in PC-12.
Mouse Anti-RPL4 Monoclonal Antibody – Cat# MBS6149432

Western Blot (WB) of anti-RPL4 antibody

RPL4 monoclonal antibody. Western Blot analysis of RPL4 expression in Raw 264.7.
Mouse Anti-RPL4 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6149432

Western Blot (WB) of anti-RPL4 antibody

RPL4 monoclonal antibody, Western Blot analysis of RPL4 expression in K-562.
Mouse Anti-RPL4 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6149432

Immunofluorescence (IF) of anti-RPL4 antibody

Immunofluorescence of monoclonal antibody to RPL4 on HeLa cell. [antibody concentration 10ug/ml]
Mouse Anti-RPL4 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6149432

Testing Data of anti-RPL4 antibody

Detection limit for recombinant GST tagged RPL4 is ~0.3ng/ml as a capture antibody.
Mouse Anti-RPL4 Monoclonal Antibody, Testing Data – Cat# MBS6149432

Other Notes

Small volumes of anti-RPL4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for RPL4. It may not necessarily be applicable to this product.

NCBI GI #
16579885
NCBI GeneID
6124
NCBI Accession #
NP_000959
UniProt Primary Accession #
P36578
UniProt Secondary Accession #
P39029; Q4VBR0; Q969Z9; A8K502
UniProt Related Accession #
P36578
GenBank Nucleotide #
NM_000968
NCBI Official Full Name
60S ribosomal protein L4
NCBI Official Synonym Full Names
ribosomal protein L4
NCBI Official Symbol
RPL4
NCBI Official Synonym Symbols
L4
UniProt Protein Name
60S ribosomal protein L4
UniProt Synonym Protein Names
60S ribosomal protein L1
Protein Family
60S ribosomal protein
UniProt Gene Name
RPL4
UniProt Synonym Gene Names
RPL1
UniProt Entry Name
RL4_HUMAN
NCBI Protein Information
60S ribosomal protein L4; 60S ribosomal protein L1

UniProt Comments for RPL4

RPL4: a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L4E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Protein type: Translation; Ribosomal

Chromosomal Location of Human Ortholog: 15q22

Cellular Component: focal adhesion; membrane; cytoplasm; nucleolus; ribonucleoprotein complex; nucleus; cytosol

Molecular Function: protein binding; structural constituent of ribosome; RNA binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; cellular protein metabolic process; translational elongation; viral reproduction; translation; mRNA catabolic process, nonsense-mediated decay; translational initiation; gene expression; viral transcription; translational termination; viral infectious cycle
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RPL4 antibody

 Reference Product  PubMed Publications
 RPS3 antibody  >4 publications with RPL4 and RPS3
 RPL6 antibody  >3 publications with RPL4 and RPL6
 RPL3 antibody  >3 publications with RPL4 and RPL3
 RPL5 antibody  >3 publications with RPL4 and RPL5
 RPL9 antibody  >3 publications with RPL4 and RPL9
 RPS14 antibody  >2 publications with RPL4 and RPS14
 RPS5 antibody  >1 publications with RPL4 and RPS5
 RPL11 antibody  >1 publications with RPL4 and RPL11

Pathways associated with anti-RPL4 antibody

 Products by Pathway  Pathway Diagram
 Cap-dependent Translation Initiation Pathway antibodies  Cap-dependent Translation Initiation Pathway Diagram
 Cytoplasmic Ribosomal Proteins Pathway antibodies  Cytoplasmic Ribosomal Proteins Pathway Diagram
 Disease Pathway antibodies  Disease Pathway Diagram
 Eukaryotic Translation Elongation Pathway antibodies  Eukaryotic Translation Elongation Pathway Diagram
 Eukaryotic Translation Initiation Pathway antibodies  Eukaryotic Translation Initiation Pathway Diagram
 Eukaryotic Translation Termination Pathway antibodies  Eukaryotic Translation Termination Pathway Diagram
 Formation Of A Pool Of Free 40S Subunits Pathway antibodies  Formation Of A Pool Of Free 40S Subunits Pathway Diagram
 GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway antibodies  GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Influenza Infection Pathway antibodies  Influenza Infection Pathway Diagram

Diseases associated with anti-RPL4 antibody

 Disease Name  Pubmed Publications
 Gastrointestinal Diseases Antibodies  >1 publications with RPL4 and Gastrointestinal Diseases
 Ovarian Neoplasms Antibodies  >1 publications with RPL4 and Ovarian Neoplasms
 Congenital Abnormalities Antibodies  >1 publications with RPL4 and Congenital Abnormalities
 Liver Diseases Antibodies  >1 publications with RPL4 and Liver Diseases
 Anemia Antibodies  >1 publications with RPL4 and Anemia
 Heart Diseases Antibodies  >1 publications with RPL4 and Heart Diseases
 Hepatitis Antibodies  >1 publications with RPL4 and Hepatitis
 Hyperplasia Antibodies  >1 publications with RPL4 and Hyperplasia
 Liver Neoplasms Antibodies  >1 publications with RPL4 and Liver Neoplasms
 Carcinoma, Hepatocellular Antibodies  >1 publications with RPL4 and Carcinoma, Hepatocellular

Organs/Tissues associated with anti-RPL4 antibody

 Organ/Tissue Name  Pubmed Publications
 Liver Antibodies  >5 publications with RPL4 and Liver
 Brain Antibodies  >5 publications with RPL4 and Brain
 Blood Antibodies  >3 publications with RPL4 and Blood
 Kidney Antibodies  >2 publications with RPL4 and Kidney
 Bone Antibodies  >2 publications with RPL4 and Bone
 Heart Antibodies  >2 publications with RPL4 and Heart
 Bone Marrow Antibodies  >2 publications with RPL4 and Bone Marrow
 Ovary Antibodies  >2 publications with RPL4 and Ovary
 Muscle Antibodies  >2 publications with RPL4 and Muscle
 Stomach Antibodies  >2 publications with RPL4 and Stomach
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000