• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

AMOT Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6151194

This gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
AMOT, Monoclonal Antibody
Full Product Name
AMOT (Angiomotin, KIAA1071) (HRP)
Product Gene Name
anti-AMOT antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human AMOT.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
73kDa
OMIM
300410
3D Structure
ModBase 3D Structure for Q4VCS5
Immunogen
Partial recombinant protein corresponding to aa361-461 from human AMOT (NP_573572) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERG
Conjugate
HRP

Product Categories/Family for anti-AMOT antibody

Antibodies; Binding Proteins
Applications Tested/Suitable for anti-AMOT antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-AMOT antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-AMOT antibody

Western Blot detection against Immunogen (37.11kD).
Mouse Anti-AMOT Monoclonal Antibody – Cat# MBS6151194

Testing Data of anti-AMOT antibody

Detection limit for recombinant GST tagged AMOT is 0.3ng/ml as a capture antibody.
Mouse Anti-AMOT Monoclonal Antibody, Testing Data – Cat# MBS6151194

Other Notes

Small volumes of anti-AMOT antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for AMOT purchase

MBS6151194 is an antibody targeting AMOT. Also known as AMOT (Angiomotin, KIAA1071) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for AMOT. It may not necessarily be applicable to this product.

NCBI GI #
19111150
NCBI GeneID
154796
NCBI Accession #
NP_573572
UniProt Primary Accession #
Q4VCS5
UniProt Related Accession #
Q4VCS5
GenBank Nucleotide #
NM_133265
NCBI Official Full Name
angiomotin isoform 2
NCBI Official Synonym Full Names
angiomotin
NCBI Official Symbol
AMOT
UniProt Protein Name
Angiomotin
Protein Family
Angiomotin
UniProt Gene Name
AMOT
UniProt Synonym Gene Names
KIAA1071
UniProt Entry Name
AMOT_HUMAN
NCBI Protein Information
angiomotin

UniProt Comments for AMOT

AMOT: Plays a central role in tight junction maintenance via the complex formed with ARHGAP17, which acts by regulating the uptake of polarity proteins at tight junctions. Appears to regulate endothelial cell migration and tube formation. May also play a role in the assembly of endothelial cell-cell junctions. Belongs to the angiomotin family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: Xq23

Cellular Component: signalosome; ruffle; cell surface; tight junction; endocytic vesicle; lamellipodium; cytoplasm; integral to membrane; stress fiber; actin filament; cytosol; external side of plasma membrane

Molecular Function: angiostatin binding; protein binding; receptor activity

Biological Process: intercellular junction assembly; blood vessel endothelial cell migration; positive regulation of cell size; in utero embryonic development; positive regulation of blood vessel endothelial cell migration; gastrulation with mouth forming second; chemotaxis; regulation of cell migration; negative regulation of angiogenesis; regulation of small GTPase mediated signal transduction; positive regulation of embryonic development; positive regulation of stress fiber formation; negative regulation of vascular permeability; vasculogenesis; actin cytoskeleton organization and biogenesis; cell migration involved in gastrulation
Show more

Research Articles on AMOT

1. Angiomotin promotes prostate cancer cell proliferation by signaling through the Hippo-YAP pathway.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-AMOT antibody

 Reference Product  PubMed Publications
 YAP1 antibody  >7 publications with AMOT and YAP1
 MPP5 antibody  >2 publications with AMOT and MPP5

Pathways associated with anti-AMOT antibody

 Products by Pathway  Pathway Diagram
 Hippo Signaling Pathway antibodies  Hippo Signaling Pathway Diagram
 Hippo Signaling Pathway antibodies  Hippo Signaling Pathway Diagram
 Signal Transduction Pathway antibodies  Signal Transduction Pathway Diagram
 Signaling By Hippo Pathway antibodies  Signaling By Hippo Pathway Diagram

Diseases associated with anti-AMOT antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >12 publications with AMOT and Neoplasms
 Disease Models, Animal Antibodies  >3 publications with AMOT and Disease Models, Animal
 Liver Neoplasms Antibodies  >2 publications with AMOT and Liver Neoplasms
 Inflammation Antibodies  >2 publications with AMOT and Inflammation
 Neoplasms, Experimental Antibodies  >2 publications with AMOT and Neoplasms, Experimental
 Kidney Diseases Antibodies  >2 publications with AMOT and Kidney Diseases
 Liver Diseases Antibodies  >2 publications with AMOT and Liver Diseases
 Cell Transformation, Neoplastic Antibodies  >2 publications with AMOT and Cell Transformation, Neoplastic
 Necrosis Antibodies  >2 publications with AMOT and Necrosis
 Neoplasm Metastasis Antibodies  >1 publications with AMOT and Neoplasm Metastasis

Organs/Tissues associated with anti-AMOT antibody

 Organ/Tissue Name  Pubmed Publications
 Kidney Antibodies  >5 publications with AMOT and Kidney
 Lung Antibodies  >3 publications with AMOT and Lung
 Muscle Antibodies  >3 publications with AMOT and Muscle
 Placenta Antibodies  >3 publications with AMOT and Placenta
 Connective Tissue Antibodies  >2 publications with AMOT and Connective Tissue
 Ovary Antibodies  >2 publications with AMOT and Ovary
 Brain Antibodies  >2 publications with AMOT and Brain
 Mammary Gland Antibodies  >1 publications with AMOT and Mammary Gland
 Skin Antibodies  >1 publications with AMOT and Skin
 Uterus Antibodies  >1 publications with AMOT and Uterus
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000