• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ANGPT4 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6151202

MBS6151202 is an antibody targeting ANGPT4. Also known as ANGPT4 (Angiopoietin 4, ANG-4, Angiopoietin 3, ANG-3, ANG3, ANG4, MGC138181, MGC138183, PRO0628) (HRP). Reactive in Human. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ANGPT4, Monoclonal Antibody
Full Product Name
ANGPT4 (Angiopoietin 4, ANG-4, Angiopoietin 3, ANG-3, ANG3, ANG4, MGC138181, MGC138183, PRO0628) (HRP)
Product Gene Name
anti-ANGPT4 antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1B7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ANGPT4.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
46,416 Da
OMIM
603705
3D Structure
ModBase 3D Structure for Q9Y264
Immunogen
Partial recombinant corresponding to aa25-112 from human ANGPT4 (NP_057069) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTI
Conjugate
HRP

Product Categories/Family for anti-ANGPT4 antibody

Antibodies; Angiopoietin
Applications Tested/Suitable for anti-ANGPT4 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes for anti-ANGPT4 antibody
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ANGPT4 antibody

Western Blot detection against Immunogen (35.68kD).
Mouse Anti-ANGPT4 Monoclonal Antibody – Cat# MBS6151202

Immunohistochemistry (IHC) of anti-ANGPT4 antibody

Immunoperoxidase of monoclonal antibody to ANGPT4 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].
Mouse Anti-ANGPT4 Monoclonal Antibody, Immunohistochemistry (IHC) – Cat# MBS6151202

Testing Data of anti-ANGPT4 antibody

Detection limit for recombinant GST tagged ANGPT4 is 0.3ng/ml as a capture antibody.
Mouse Anti-ANGPT4 Monoclonal Antibody, Testing Data – Cat# MBS6151202

Other Notes

Small volumes of anti-ANGPT4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ANGPT4. It may not necessarily be applicable to this product.

NCBI GI #
7705276
NCBI GeneID
51378
NCBI Accession #
NP_057069
UniProt Primary Accession #
Q9Y264
UniProt Secondary Accession #
Q5TFF4; Q9H4Z4; B4E3J9
UniProt Related Accession #
Q9Y264
GenBank Nucleotide #
NM_015985
NCBI Official Full Name
angiopoietin-4
NCBI Official Synonym Full Names
angiopoietin 4
NCBI Official Symbol
ANGPT4
NCBI Official Synonym Symbols
AGP4; ANG4; ANG-3
UniProt Protein Name
Angiopoietin-4
UniProt Synonym Protein Names
Angiopoietin-3
Protein Family
Angiopoietin
UniProt Gene Name
ANGPT4
UniProt Synonym Gene Names
ANG3; ANG4; ANG-4; ANG-3
UniProt Entry Name
ANGP4_HUMAN
NCBI Protein Information
angiopoietin-4; ANG-4; angiopoietin-3; dJ824F16.2 (angiopoietin 4)

UniProt Comments for ANGPT4

ANGPT4: Binds to TEK/TIE2, modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2. Promotes endothelial cell survival, migration and angiogenesis.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: extracellular space; extracellular region

Molecular Function: transmembrane receptor protein tyrosine kinase activator activity; receptor tyrosine kinase binding

Biological Process: negative regulation of angiogenesis; positive regulation of angiogenesis; positive regulation of peptidyl-tyrosine phosphorylation; transmembrane receptor protein tyrosine kinase activation (dimerization); endothelial cell proliferation; positive regulation of blood vessel endothelial cell migration; angiogenesis; blood coagulation; negative regulation of blood vessel endothelial cell migration; leukocyte migration; negative regulation of apoptosis
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ANGPT4 antibody

 Reference Product  PubMed Publications
 ANGPT2 antibody  >4 publications with ANGPT4 and ANGPT2
 TIE1 antibody  >1 publications with ANGPT4 and TIE1
 TEK antibody  >1 publications with ANGPT4 and TEK

Pathways associated with anti-ANGPT4 antibody

 Products by Pathway  Pathway Diagram
 Angiopoietin Receptor Tie2-mediated Signaling Pathway antibodies  Angiopoietin Receptor Tie2-mediated Signaling Pathway Diagram
 Cell Surface Interactions At The Vascular Wall Pathway antibodies  Cell Surface Interactions At The Vascular Wall Pathway Diagram
 HIF-1 Signaling Pathway antibodies  HIF-1 Signaling Pathway Diagram
 Hemostasis Pathway antibodies  Hemostasis Pathway Diagram
 PI3K-Akt Signaling Pathway antibodies  PI3K-Akt Signaling Pathway Diagram
 PI3K-Akt Signaling Pathway antibodies  PI3K-Akt Signaling Pathway Diagram
 Rap1 Signaling Pathway antibodies  Rap1 Signaling Pathway Diagram
 Rap1 Signaling Pathway antibodies  Rap1 Signaling Pathway Diagram
 Ras Signaling Pathway antibodies  Ras Signaling Pathway Diagram
 Tie2 Signaling Pathway antibodies  Tie2 Signaling Pathway Diagram

Diseases associated with anti-ANGPT4 antibody

 Disease Name  Pubmed Publications
 Vascular Diseases Antibodies  >2 publications with ANGPT4 and Vascular Diseases
 Inflammation Antibodies  >2 publications with ANGPT4 and Inflammation
 Dementia Antibodies  >1 publications with ANGPT4 and Dementia
 Cerebrovascular Disorders Antibodies  >1 publications with ANGPT4 and Cerebrovascular Disorders
 Nervous System Diseases Antibodies  >1 publications with ANGPT4 and Nervous System Diseases
 Cardiovascular Diseases Antibodies  >1 publications with ANGPT4 and Cardiovascular Diseases

Organs/Tissues associated with anti-ANGPT4 antibody

 Organ/Tissue Name  Pubmed Publications
 Uterus Antibodies  >2 publications with ANGPT4 and Uterus
 Placenta Antibodies  >1 publications with ANGPT4 and Placenta
 Testis Antibodies  >1 publications with ANGPT4 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000