Mouse Anti-RCE1 Monoclonal Antibody – Cat# MBS6154581

Western Blot detection against Immunogen (31.24kD).

RCE1 Antibody – Mouse Monoclonal

Name: RCE1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6154581
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6154581

RCE1 is an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

RCE1, Monoclonal Antibody

Full Product Name

RCE1 (CAAX Prenyl Protease 2, Prenyl Protein-specific Endoprotease 2, Farnesylated Proteins-converting Enzyme 2, FACE-2, RCE1 Homolog, hRCE1, FACE2, RCE1A, RCE1B) (HRP)

Product Gene Name

anti-RCE1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

6A6

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human RCE1.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

OMIM

605385

3D Structure

ModBase 3D Structure for Q9Y256

Immunogen

Partial recombinant corresponding to aa133-182 from RCE1 (NP_005124) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

QLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRAC

Conjugate

HRP

Product Categories/Family for anti-RCE1 antibody

Antibodies; Enzymes; Protease (Proteinase; Peptidase)

Applications Tested/Suitable for anti-RCE1 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-RCE1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-RCE1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RCE1 purchase

MBS6154581 is an antibody targeting RCE1. Also known as RCE1 (CAAX Prenyl Protease 2, Prenyl Protein-specific Endoprotease 2, Farnesylated Proteins-converting Enzyme 2, FACE-2, RCE1 Homolog, hRCE1, FACE2, RCE1A, RCE1B) (HRP). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for RCE1. It may not necessarily be applicable to this product.

NCBI GI #

1653960759

NCBI GeneID

9986

NCBI Accession #

NM_005133.3

UniProt Primary Accession #

Q9Y256

UniProt Related Accession #

Q9Y256

GenBank Nucleotide #

NM_005133

NCBI Official Full Name

Homo sapiens Ras converting CAAX endopeptidase 1 (RCE1), transcript variant 1, mRNA

NCBI Official Synonym Full Names

Ras converting CAAX endopeptidase 1

NCBI Official Symbol

RCE1

NCBI Official Synonym Symbols

FACE2; RCE1A; RCE1B

UniProt Protein Name

CAAX prenyl protease 2

UniProt Synonym Protein Names

Farnesylated proteins-converting enzyme 2; FACE-2; Prenyl protein-specific endoprotease 2; RCE1 homolog; hRCE1

UniProt Gene Name

RCE1

UniProt Synonym Gene Names

FACE2; RCE1A; RCE1B; FACE-2; hRCE1

UniProt Entry Name

FACE2_HUMAN

NCBI Protein Information

CAAX prenyl protease 2

NCBI Summary for RCE1

This gene encodes an integral membrane protein which is classified as a member of the metalloproteinase family. This enzyme is thought to function in the maintenance and processing of CAAX-type prenylated proteins. [provided by RefSeq, Jul 2008]

UniProt Comments for RCE1

RCE1: Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1. Belongs to the peptidase U48 family.

Protein type: EC 3.4.22.-; Membrane protein, multi-pass; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane; integral to plasma membrane; membrane

Molecular Function: cysteine-type endopeptidase activity; endopeptidase activity; metalloendopeptidase activity

Biological Process: proteolysis

Research Articles on RCE1

1. High expression of Rce1 is associated with renal cell carcinoma.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.