• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

CDK2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6157026

CDK2 a serine/threonine protein kinase, is a member of a highly conserved family of protein kinases that regulate the eukaryotic cell cycle. The protein kinase is homologous to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. For activity, it… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
CDK2, Monoclonal Antibody
Full Product Name
CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (PE)
Product Gene Name
anti-CDK2 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human CDK2.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
30,035 Da
Immunogen
Partial recombinant corresponding to aa211-298 from human CDK2 (AAH03065) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Conjugate
PE

Product Categories/Family for anti-CDK2 antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-CDK2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-CDK2 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-CDK2 antibody

Western Blot detection against Immunogen (35.42kD).
Mouse Anti-CDK2 Monoclonal Antibody – Cat# MBS6157026

Western Blot (WB) of anti-CDK2 antibody

CDK2 monoclonal antibody, Western Blot analysis of CDK2 expression in HL-60.
Mouse Anti-CDK2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157026

Western Blot (WB) of anti-CDK2 antibody

Western Blot analysis of CDK2 expression in transfected 293T cell line by CDK2 monoclonal antibody. Lane 1: CDK2 transfected lysate (33.9kD). Lane 2: Non-transfected lysate.
Mouse Anti-CDK2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157026

Testing Data of anti-CDK2 antibody

Detection limit for recombinant GST tagged CDK2 is ~0.03ng/ml as a capture antibody.
Mouse Anti-CDK2 Monoclonal Antibody, Testing Data – Cat# MBS6157026

Western Blot (WB) of anti-CDK2 antibody

Western blot analysis of CDK2 over-expressed 293 cell line, cotransfected with CDK2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDK2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.
Mouse Anti-CDK2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157026

Western Blot (WB) of anti-CDK2 antibody

CDK2 monoclonal antibody. Western Blot analysis of CDK2 expression in Jurkat.
Mouse Anti-CDK2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6157026

Other Notes

Small volumes of anti-CDK2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CDK2 purchase

MBS6157026 is an antibody targeting CDK2. Also known as CDK2 (Cell Division Protein Kinase 2, p33 Protein Kinase) (PE). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CDK2. It may not necessarily be applicable to this product.

NCBI GI #
33869456
NCBI GeneID
1017
NCBI Accession #
BC003065
NCBI Related Accession #
AAH03065
UniProt Secondary Accession #
O75100; A8K7C6
UniProt Related Accession #
P24941
NCBI Official Full Name
Homo sapiens cyclin-dependent kinase 2, mRNA
NCBI Official Synonym Full Names
cyclin dependent kinase 2
NCBI Official Symbol
CDK2
NCBI Official Synonym Symbols
CDKN2; p33(CDK2)
Protein Family
Cyclin-dependent kinase
NCBI Protein Information
cyclin-dependent kinase 2

NCBI Summary for CDK2

This gene encodes a member of a family of serine/threonine protein kinases that participate in cell cycle regulation. The encoded protein is the catalytic subunit of the cyclin-dependent protein kinase complex, which regulates progression through the cell cycle. Activity of this protein is especially critical during the G1 to S phase transition. This protein associates with and regulated by other subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A), and p27Kip1 (CDKN1B). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Show more

Research Articles on CDK2

1. Foxo3 circular RNA retards cell cycle progression via forming ternary complexes with p21 and CDK2.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CDK2 antibody

 Products by Pathway  Pathway Diagram
 APC/C-mediated Degradation Of Cell Cycle Proteins Pathway antibodies  APC/C-mediated Degradation Of Cell Cycle Proteins Pathway Diagram
 Activation Of ATR In Response To Replication Stress Pathway antibodies  Activation Of ATR In Response To Replication Stress Pathway Diagram
 Activation Of The Pre-replicative Complex Pathway antibodies  Activation Of The Pre-replicative Complex Pathway Diagram
 B Cell Receptor Signaling Pathway antibodies  B Cell Receptor Signaling Pathway Diagram
 BARD1 Signaling Events Pathway antibodies  BARD1 Signaling Events Pathway Diagram
 CDK-mediated Phosphorylation And Removal Of Cdc6 Pathway antibodies  CDK-mediated Phosphorylation And Removal Of Cdc6 Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram
 Cell Cycle Checkpoints Pathway antibodies  Cell Cycle Checkpoints Pathway Diagram
 Cell Cycle, Mitotic Pathway antibodies  Cell Cycle, Mitotic Pathway Diagram
 Cell Cycle Pathway antibodies  Cell Cycle Pathway Diagram

Diseases associated with anti-CDK2 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >1783 publications with CDK2 and Neoplasms
 Breast Neoplasms Antibodies  >342 publications with CDK2 and Breast Neoplasms
 Adenocarcinoma Antibodies  >253 publications with CDK2 and Adenocarcinoma
 Neoplasms, Experimental Antibodies  >183 publications with CDK2 and Neoplasms, Experimental
 Drug Toxicity Antibodies  >157 publications with CDK2 and Drug Toxicity
 Liver Diseases Antibodies  >145 publications with CDK2 and Liver Diseases
 Liver Neoplasms Antibodies  >137 publications with CDK2 and Liver Neoplasms
 Prostatic Neoplasms Antibodies  >136 publications with CDK2 and Prostatic Neoplasms
 Lung Neoplasms Antibodies  >120 publications with CDK2 and Lung Neoplasms
 Carcinoma, Hepatocellular Antibodies  >119 publications with CDK2 and Carcinoma, Hepatocellular

Organs/Tissues associated with anti-CDK2 antibody

 Organ/Tissue Name  Pubmed Publications
 Lymph Node Antibodies  >31 publications with CDK2 and Lymph Node
 Uterus Antibodies  >28 publications with CDK2 and Uterus
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000