• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

STAT5A Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6160533

Two highly related, but distinct STAT5 genes (STAT5a and STAT5b) were identified in mice. The aa sequences of Stat5a and Stat5b show approximately 96% sequence similarity, and both proteins are co-expressed in most tissues of both virgin and lactating mice.… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
STAT5A, Monoclonal Antibody
Full Product Name
STAT5A (Signal Transducer and Activator of Transcription 5A, STAT5) (PE)
Product Gene Name
anti-STAT5A antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1B12
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human STAT5A.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
90,647 Da
Chromosome Location
Chromosome: 17; NC_000017.10 (40439565..40463961). Location: 17q11.2
OMIM
601511
3D Structure
ModBase 3D Structure for P42229
Immunogen
Partial recombinant corresponding to aa1-104 from human STAT5A (AAH27036) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLE
Conjugate
PE

Product Categories/Family for anti-STAT5A antibody

Antibodies; Transcription Factors; STAT
Applications Tested/Suitable for anti-STAT5A antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-STAT5A antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-STAT5A antibody

STAT5A monoclonal antibody, Western Blot analysis of STAT5A expression in k-562.
Mouse Anti-STAT5A Monoclonal Antibody – Cat# MBS6160533

Western Blot (WB) of anti-STAT5A antibody

Western Blot analysis of STAT5A expression in transfected 293T cell line by STAT5A monoclonal antibody. Lane 1: STAT5A transfected lysate (Predicted MW: 90.6kD). Lane 2: Non-transfected lysate.
Mouse Anti-STAT5A Monoclonal Antibody, Western Blot (WB) – Cat# MBS6160533

Testing Data of anti-STAT5A antibody

Detection limit for recombinant GST tagged STAT5A is ~0.1ng/ml as a capture antibody.
Mouse Anti-STAT5A Monoclonal Antibody, Testing Data – Cat# MBS6160533

Testing Data of anti-STAT5A antibody

Proximity Ligation Analysis (PLA) of protein-protein interactions between STAT1 and STAT5A HeLa cells were stained with STAT1 rabbit purified polyclonal 1:1200 and STAT5A mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.
Mouse Anti-STAT5A Monoclonal Antibody, Testing Data – Cat# MBS6160533

Other Notes

Small volumes of anti-STAT5A antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for STAT5A purchase

MBS6160533 is an antibody targeting STAT5A. Also known as STAT5A (Signal Transducer and Activator of Transcription 5A, STAT5) (PE). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for STAT5A. It may not necessarily be applicable to this product.

NCBI GI #
20072533
NCBI GeneID
6776
NCBI Accession #
BC027036
NCBI Related Accession #
AAH27036
UniProt Primary Accession #
P42229
UniProt Related Accession #
P42229
NCBI Official Full Name
Homo sapiens signal transducer and activator of transcription 5A, mRNA
NCBI Official Synonym Full Names
signal transducer and activator of transcription 5A
NCBI Official Symbol
STAT5A
NCBI Official Synonym Symbols
MGF; STAT5
UniProt Protein Name
Signal transducer and activator of transcription 5A
Protein Family
Signal transducer and activator of transcription
UniProt Gene Name
STAT5A
UniProt Synonym Gene Names
STAT5
UniProt Entry Name
STA5A_HUMAN
NCBI Protein Information
signal transducer and activator of transcription 5A

UniProt Comments for STAT5A

STAT5A: transcription factor of the STAT family. Phosphorylated and activated by receptor-associated kinases downstream of many cytokines and growth-factor receptors. Activation of this protein in myeloma and lymphoma associated with a TEL/JAK2 fusion protein is essential for the tumorigenesis. Induces the expression of BCL2L1/BCL-X(L) in the mouse, suggesting an antiapoptotic function of this protein. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription. Two alternatively spliced isoforms have been described.

Protein type: Motility/polarity/chemotaxis; Oncoprotein; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: nucleoplasm; cytosol

Molecular Function: signal transducer activity; protein binding; transcription factor activity

Biological Process: lactation; succinate metabolic process; peptidyl-tyrosine phosphorylation; oxaloacetate metabolic process; positive regulation of interleukin-2 biosynthetic process; T cell differentiation in the thymus; female pregnancy; positive regulation of multicellular organism growth; fatty acid metabolic process; positive regulation of mitotic cell cycle; positive regulation of activated T cell proliferation; 2-oxoglutarate metabolic process; positive regulation of natural killer cell differentiation; sequestering of lipid; negative regulation of mast cell apoptosis; natural killer cell differentiation; allantoin metabolic process; luteinization; development of secondary male sexual characteristics; regulation of steroid metabolic process; creatinine metabolic process; T cell homeostasis; positive regulation of gamma-delta T cell differentiation; Peyer's patch development; isoleucine metabolic process; negative regulation of erythrocyte differentiation; transcription, DNA-dependent; valine metabolic process; citrate metabolic process; regulation of multicellular organism growth; development of secondary female sexual characteristics; JAK-STAT cascade; positive regulation of natural killer cell mediated cytotoxicity; creatine metabolic process; regulation of transcription from RNA polymerase II promoter; regulation of epithelial cell differentiation; positive regulation of B cell differentiation; positive regulation of transcription from RNA polymerase II promoter; taurine metabolic process; positive regulation of inflammatory response
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-STAT5A antibody

 Reference Product  PubMed Publications
 JAK2 antibody  >139 publications with STAT5A and JAK2
 SRC antibody  >52 publications with STAT5A and SRC
 JAK3 antibody  >43 publications with STAT5A and JAK3
 JAK1 antibody  >34 publications with STAT5A and JAK1
 PRLR antibody  >26 publications with STAT5A and PRLR
 ERBB4 antibody  >12 publications with STAT5A and ERBB4
 PTPN11 antibody  >11 publications with STAT5A and PTPN11
 EGFR antibody  >10 publications with STAT5A and EGFR
 CRKL antibody  >4 publications with STAT5A and CRKL

Pathways associated with anti-STAT5A antibody

 Products by Pathway  Pathway Diagram
 AGE/RAGE Pathway antibodies  AGE/RAGE Pathway Diagram
 Acute Myeloid Leukemia Pathway antibodies  Acute Myeloid Leukemia Pathway Diagram
 Acute Myeloid Leukemia Pathway antibodies  Acute Myeloid Leukemia Pathway Diagram
 Adipogenesis Pathway antibodies  Adipogenesis Pathway Diagram
 Angiopoietin Receptor Tie2-mediated Signaling Pathway antibodies  Angiopoietin Receptor Tie2-mediated Signaling Pathway Diagram
 BDNF Signaling Pathway antibodies  BDNF Signaling Pathway Diagram
 CD40/CD40L Signaling Pathway antibodies  CD40/CD40L Signaling Pathway Diagram
 CXCR4-mediated Signaling Events Pathway antibodies  CXCR4-mediated Signaling Events Pathway Diagram
 Chronic Myeloid Leukemia Pathway antibodies  Chronic Myeloid Leukemia Pathway Diagram
 Chronic Myeloid Leukemia Pathway antibodies  Chronic Myeloid Leukemia Pathway Diagram

Diseases associated with anti-STAT5A antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >184 publications with STAT5A and Neoplasms
 Breast Neoplasms Antibodies  >54 publications with STAT5A and Breast Neoplasms
 Carcinoma Antibodies  >47 publications with STAT5A and Carcinoma
 Kidney Diseases Antibodies  >41 publications with STAT5A and Kidney Diseases
 Lymphoma Antibodies  >30 publications with STAT5A and Lymphoma
 Inflammation Antibodies  >26 publications with STAT5A and Inflammation
 Adenocarcinoma Antibodies  >25 publications with STAT5A and Adenocarcinoma
 Mammary Neoplasms, Animal Antibodies  >23 publications with STAT5A and Mammary Neoplasms, Animal
 Liver Diseases Antibodies  >19 publications with STAT5A and Liver Diseases
 Cardiovascular Diseases Antibodies  >19 publications with STAT5A and Cardiovascular Diseases

Organs/Tissues associated with anti-STAT5A antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >217 publications with STAT5A and Blood
 Mammary Gland Antibodies  >131 publications with STAT5A and Mammary Gland
 Liver Antibodies  >65 publications with STAT5A and Liver
 Bone Antibodies  >63 publications with STAT5A and Bone
 Kidney Antibodies  >49 publications with STAT5A and Kidney
 Lung Antibodies  >32 publications with STAT5A and Lung
 Heart Antibodies  >29 publications with STAT5A and Heart
 Muscle Antibodies  >27 publications with STAT5A and Muscle
 Brain Antibodies  >26 publications with STAT5A and Brain
 Prostate Antibodies  >25 publications with STAT5A and Prostate
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000