• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RAD18 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6163927

The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar… More details

$995 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RAD18, Monoclonal Antibody
Full Product Name
RAD18 (RAD18 Homolog (S. cerevisiae), RNF73) (AP)
Product Gene Name
anti-RAD18 antibody
Product Synonym Names
RAD18 Homolog (S. cerevisiae); RNF73
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B9
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Purity/Purification
Purified
Specificity
Recognizes RAD18.
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
56kDa
OMIM
605256
3D Structure
ModBase 3D Structure for Q9NS91
Immunogen
RAD18 (NP_064550, 332aa-430aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
Conjugate
AP

Product Categories/Family for anti-RAD18 antibody

Antibodies; Transcription Factors
Applications Tested/Suitable for anti-RAD18 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-RAD18 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-RAD18 antibody

RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in Hela S3 NE.
Mouse Anti-RAD18 Monoclonal Antibody – Cat# MBS6163927

Western Blot (WB) of anti-RAD18 antibody

RAD18 monoclonal antibody (M03), clone 2B9. Western Blot analysis of RAD18 expression in PC-12.
Mouse Anti-RAD18 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6163927

Immunofluorescence (IF) of anti-RAD18 antibody

Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-RAD18 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6163927

Immunofluorescence (IF) of anti-RAD18 antibody

Immunofluorescence of monoclonal antibody to RAD18 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-RAD18 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6163927

Other Notes

Small volumes of anti-RAD18 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RAD18 purchase

MBS6163927 is an antibody targeting RAD18. Also known as RAD18 (RAD18 Homolog (S. cerevisiae), RNF73) (AP). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for RAD18. It may not necessarily be applicable to this product.

NCBI GI #
256818821
NCBI GeneID
56852
NCBI Accession #
NP_064550
UniProt Primary Accession #
Q9NS91
UniProt Related Accession #
Q9NS91
GenBank Nucleotide #
NM_020165
NCBI Official Full Name
E3 ubiquitin-protein ligase RAD18
NCBI Official Synonym Full Names
RAD18 E3 ubiquitin protein ligase
NCBI Official Symbol
RAD18
NCBI Official Synonym Symbols
RNF73
UniProt Protein Name
E3 ubiquitin-protein ligase RAD18
UniProt Synonym Protein Names
Postreplication repair protein RAD18; hHR18; hRAD18; RING finger protein 73
Protein Family
E3 ubiquitin-protein ligase
UniProt Gene Name
RAD18
UniProt Synonym Gene Names
RNF73; hHR18; hRAD18
UniProt Entry Name
RAD18_HUMAN
NCBI Protein Information
E3 ubiquitin-protein ligase RAD18

UniProt Comments for RAD18

RAD18: a structural maintenance of chromosomes (SMC) protein involved in postreplication repair of UV-damaged DNA. Has ssDNA binding activity. Interacts with Rad6 through a conserved ring-finger motif. Rad6 is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA.

Protein type: Ubiquitin conjugating system; EC 6.3.2.-; Ubiquitin ligase; DNA repair, damage; EC 6.3.2.19; Ligase

Chromosomal Location of Human Ortholog: 3p25.3

Cellular Component: XY body; replication fork; nucleus; chromatin

Molecular Function: Y-form DNA binding; protein binding; zinc ion binding; ubiquitin protein ligase binding; damaged DNA binding; polyubiquitin binding; ligase activity

Biological Process: negative regulation of DNA recombination; protein ubiquitination; spermatogenesis; DNA repair; response to UV
Show more

Research Articles on RAD18

1. Long non-coding RNA ROR promotes radioresistance in hepatocelluar carcinoma cells by acting as a ceRNA for microRNA-145 to regulate RAD18 expression

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RAD18 antibody

 Reference Product  PubMed Publications
 UBE2A antibody  >8 publications with RAD18 and UBE2A
 UBE2B antibody  >7 publications with RAD18 and UBE2B

Diseases associated with anti-RAD18 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >14 publications with RAD18 and Neoplasms
 Skin Neoplasms Antibodies  >3 publications with RAD18 and Skin Neoplasms
 Carcinoma, Squamous Cell Antibodies  >3 publications with RAD18 and Carcinoma, Squamous Cell
 Lung Neoplasms Antibodies  >2 publications with RAD18 and Lung Neoplasms
 Precancerous Conditions Antibodies  >2 publications with RAD18 and Precancerous Conditions
 Weight Loss Antibodies  >2 publications with RAD18 and Weight Loss
 Nervous System Diseases Antibodies  >2 publications with RAD18 and Nervous System Diseases
 Cell Transformation, Neoplastic Antibodies  >1 publications with RAD18 and Cell Transformation, Neoplastic
 Breast Neoplasms Antibodies  >1 publications with RAD18 and Breast Neoplasms
 Inflammation Antibodies  >1 publications with RAD18 and Inflammation

Organs/Tissues associated with anti-RAD18 antibody

 Organ/Tissue Name  Pubmed Publications
 Testis Antibodies  >9 publications with RAD18 and Testis
 Skin Antibodies  >6 publications with RAD18 and Skin
 Blood Antibodies  >5 publications with RAD18 and Blood
 Lung Antibodies  >4 publications with RAD18 and Lung
 Bone Antibodies  >3 publications with RAD18 and Bone
 Liver Antibodies  >2 publications with RAD18 and Liver
 Bone Marrow Antibodies  >2 publications with RAD18 and Bone Marrow
 Ovary Antibodies  >2 publications with RAD18 and Ovary
 Thymus Antibodies  >2 publications with RAD18 and Thymus
 Brain Antibodies  >2 publications with RAD18 and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000