Mouse Anti-IL17B Monoclonal Antibody – Cat# MBS6165138

Western Blot analysis of IL17B expression in transfected 293T cell line by IL17B monoclonal antibody (M02), clone 1G6.

Lane 1: IL17B transfected lysate(20.4 KDa).
Lane 2: Non-transfected lysate.

IL17B Antibody – Mouse Monoclonal

Name: IL17B Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6165138
Price: 995 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6165138

$995 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

IL17B, Monoclonal Antibody

Full Product Name

IL17B (Interleukin 17B, IL-17B, IL-20, MGC138900, MGC138901, ZCYTO7) (AP)

Product Gene Name

anti-IL17B antibody

Product Synonym Names

Interleukin 17B; IL-17B; IL-20; MGC138900; MGC138901; ZCYTO7

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1G6

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

Purity/Purification

Purified

Specificity

Recognizes IL17B.

Preparation and Storage

Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

20 kDa (185aa)

OMIM

604627

3D Structure

ModBase 3D Structure for Q9UHF5

Immunogen

IL17B (NP_055258, 23aa-122aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

RSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCL

Conjugate

Product Categories/Family for anti-IL17B antibody

Antibodies; Interleukin

Applications Tested/Suitable for anti-IL17B antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-IL17B antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-IL17B antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for IL17B purchase

MBS6165138 is an antibody targeting IL17B. Also known as IL17B (Interleukin 17B, IL-17B, IL-20, MGC138900, MGC138901, ZCYTO7) (AP). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for IL17B. It may not necessarily be applicable to this product.

NCBI GI #

7657228

NCBI GeneID

27190

NCBI Accession #

NP_055258

UniProt Primary Accession #

Q9UHF5

UniProt Secondary Accession #

Q14CE5

UniProt Related Accession #

Q9UHF5

GenBank Nucleotide #

NM_014443.2

NCBI Official Full Name

interleukin-17B isoform 1

NCBI Official Synonym Full Names

interleukin 17B

NCBI Official Symbol

IL17B

NCBI Official Synonym Symbols

NIRF; IL-20; IL-17B; ZCYTO7

UniProt Protein Name

Interleukin-17B

UniProt Synonym Protein Names

Cytokine Zcyto7; Interleukin-20; IL-20; Neuronal interleukin-17-related factor

Protein Family

Interleukin

UniProt Gene Name

IL17B

UniProt Synonym Gene Names

IL20; NIRF; ZCYTO7; IL-17B; IL-20

UniProt Entry Name

IL17B_HUMAN

NCBI Protein Information

interleukin-17B

NCBI Summary for IL17B

The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of several nerve tissues indicated that this cytokine is primarily localized to neuronal cell bodies. Alternative splicing results in multiple splice variants. [provided by RefSeq, Dec 2015]

UniProt Comments for IL17B

IL17B: Stimulates the release of tumor necrosis factor alpha and IL-1-beta from the monocytic cell line THP-1. Belongs to the IL-17 family.

Protein type: Secreted; Secreted, signal peptide; Cytokine

Chromosomal Location of Human Ortholog: 5q33.1

Cellular Component: extracellular space

Molecular Function: cytokine activity

Biological Process: cell-cell signaling; immune response; inflammatory response

Research Articles on IL17B

1. Our data revealed a new mechanism that IL-17B enhanced the progression of gastric cancer by activating mesenchymal stem cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-IL17B antibody

Products by Pathway	Pathway Diagram
Aryl Hydrocarbon Receptor Pathway antibodies	Aryl Hydrocarbon Receptor Pathway Diagram
Cytokine-cytokine Receptor Interaction Pathway antibodies	Cytokine-cytokine Receptor Interaction Pathway Diagram
Cytokine-cytokine Receptor Interaction Pathway antibodies	Cytokine-cytokine Receptor Interaction Pathway Diagram
IL-17 Signaling Pathway antibodies	IL-17 Signaling Pathway Diagram
IL-17 Signaling Pathway antibodies	IL-17 Signaling Pathway Diagram
IL17 Signaling Pathway antibodies	IL17 Signaling Pathway Diagram

Diseases associated with anti-IL17B antibody

Disease Name	Pubmed Publications
Necrosis Antibodies	>5 publications with IL17B and Necrosis
Inflammation Antibodies	>4 publications with IL17B and Inflammation
Disease Models, Animal Antibodies	>3 publications with IL17B and Disease Models, Animal
Neurobehavioral Manifestations Antibodies	>1 publications with IL17B and Neurobehavioral Manifestations
Liver Neoplasms Antibodies	>1 publications with IL17B and Liver Neoplasms
Nervous System Diseases Antibodies	>1 publications with IL17B and Nervous System Diseases
Drug-Related Side Effects and Adverse Reactions Antibodies	>1 publications with IL17B and Drug-Related Side Effects and Adverse Reactions

Organs/Tissues associated with anti-IL17B antibody

Organ/Tissue Name	Pubmed Publications
Bone Antibodies	>4 publications with IL17B and Bone
Heart Antibodies	>1 publications with IL17B and Heart
Lung Antibodies	>1 publications with IL17B and Lung