• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

OSR1 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6167598

MBS6167598 is an antibody targeting OSR1. Also known as OSR1 (Odd-skipped Related 1 (Drosophila), ODD) (APC). Host: Mouse. Mouse monoclonal antibody raised against a partial recombinant OSR1. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
OSR1, Monoclonal Antibody
Full Product Name
OSR1 (Odd-skipped Related 1 (Drosophila), ODD) (APC)
Product Gene Name
anti-OSR1 antibody
Product Synonym Names
Odd-skipped Related 1 (Drosophila); ODD
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3F6
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified
Specificity
Recognizes OSR1.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
29,611 Da
OMIM
608891
3D Structure
ModBase 3D Structure for Q8TAX0
Immunogen
OSR1 (NP_660303, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP
Conjugate
APC

Product Categories/Family for anti-OSR1 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger
Applications Tested/Suitable for anti-OSR1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes for anti-OSR1 antibody
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-OSR1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for OSR1. It may not necessarily be applicable to this product.

NCBI GI #
21687100
NCBI GeneID
130497
NCBI Accession #
NP_660303
UniProt Primary Accession #
Q8TAX0
UniProt Secondary Accession #
B3KV97; D6W521
UniProt Related Accession #
Q8TAX0
GenBank Nucleotide #
NM_145260
NCBI Official Full Name
protein odd-skipped-related 1
NCBI Official Synonym Full Names
odd-skipped related transciption factor 1
NCBI Official Symbol
OSR1
NCBI Official Synonym Symbols
ODD
UniProt Protein Name
Protein odd-skipped-related 1
Protein Family
Protein odd-skipped
UniProt Gene Name
OSR1
UniProt Synonym Gene Names
ODD
UniProt Entry Name
OSR1_HUMAN
NCBI Protein Information
protein odd-skipped-related 1; odd-skipped homolog; odd-skipped related 1

UniProt Comments for OSR1

ODD: Transcription factor that plays a role in the regulation of embryonic heart and urogenital development. Belongs to the Odd C2H2-type zinc-finger protein family.

Protein type: Apoptosis; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 2p24.1

Cellular Component: nucleus

Molecular Function: nucleic acid binding; metal ion binding

Biological Process: embryonic forelimb morphogenesis; gonad development; transcription, DNA-dependent; heart development; intermediate mesoderm development; negative regulation of epithelial cell differentiation; palate development; middle ear morphogenesis; negative regulation of transcription from RNA polymerase II promoter; stem cell differentiation; positive regulation of bone mineralization; embryonic hindlimb morphogenesis; pronephros development; odontogenesis; ureteric bud development; chondrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; mesonephros development; embryonic digit morphogenesis; cell differentiation; positive regulation of epithelial cell proliferation; urogenital system development; negative regulation of apoptosis
Show more

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-OSR1 antibody

 Reference Product  PubMed Publications
 OXSR1 antibody  >17 publications with OSR1 and OXSR1
 RUNX2 antibody  >2 publications with OSR1 and RUNX2

Diseases associated with anti-OSR1 antibody

 Disease Name  Pubmed Publications
 Hypertension Antibodies  >46 publications with OSR1 and Hypertension
 Kidney Diseases Antibodies  >27 publications with OSR1 and Kidney Diseases
 Cardiovascular Diseases Antibodies  >18 publications with OSR1 and Cardiovascular Diseases
 Vascular Diseases Antibodies  >17 publications with OSR1 and Vascular Diseases
 Cell Transformation, Neoplastic Antibodies  >4 publications with OSR1 and Cell Transformation, Neoplastic
 Nervous System Diseases Antibodies  >4 publications with OSR1 and Nervous System Diseases
 Kidney Neoplasms Antibodies  >3 publications with OSR1 and Kidney Neoplasms
 Carcinoma Antibodies  >3 publications with OSR1 and Carcinoma
 Prostatic Diseases Antibodies  >2 publications with OSR1 and Prostatic Diseases
 Necrosis Antibodies  >2 publications with OSR1 and Necrosis

Organs/Tissues associated with anti-OSR1 antibody

 Organ/Tissue Name  Pubmed Publications
 Embryonic Tissue Antibodies  >21 publications with OSR1 and Embryonic Tissue
 Heart Antibodies  >13 publications with OSR1 and Heart
 Brain Antibodies  >12 publications with OSR1 and Brain
 Intestine Antibodies  >6 publications with OSR1 and Intestine
 Eye Antibodies  >6 publications with OSR1 and Eye
 Prostate Antibodies  >5 publications with OSR1 and Prostate
 Lung Antibodies  >4 publications with OSR1 and Lung
 Connective Tissue Antibodies  >3 publications with OSR1 and Connective Tissue
 Mouth Antibodies  >3 publications with OSR1 and Mouth
 Testis Antibodies  >3 publications with OSR1 and Testis
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000