• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

HOXC4 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6167889

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters,… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
HOXC4, Monoclonal Antibody
Full Product Name
HOXC4 (Homeobox C4, HOX3, HOX3E, cp19) (APC)
Product Gene Name
anti-HOXC4 antibody
Product Synonym Names
Homeobox C4; HOX3; HOX3E; cp19
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D6
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified
Specificity
Recognizes HOXC4.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
29kDa
OMIM
142974
3D Structure
ModBase 3D Structure for P09017
Immunogen
HOXC4 (NP_705897, 160aa-264aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPPEQQRAEDITRL
Conjugate
APC

Product Categories/Family for anti-HOXC4 antibody

Antibodies; Transcription Factors; Homeobox (HOX)
Applications Tested/Suitable for anti-HOXC4 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-HOXC4 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-HOXC4 antibody

HOXC4 monoclonal antibody (M02), clone 2D6 Western Blot analysis of HOXC4 expression in K-562.
Mouse Anti-HOXC4 Monoclonal Antibody – Cat# MBS6167889

Immunofluorescence (IF) of anti-HOXC4 antibody

Immunofluorescence of monoclonal antibody to HOXC4 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-HOXC4 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6167889

Immunofluorescence (IF) of anti-HOXC4 antibody

Immunofluorescence of monoclonal antibody to HOXC4 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-HOXC4 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6167889

Testing Data of anti-HOXC4 antibody

Detection limit for recombinant GST tagged HOXC4 is approximately 0.03ng/ml as a capture antibody.
Mouse Anti-HOXC4 Monoclonal Antibody, Testing Data – Cat# MBS6167889

Other Notes

Small volumes of anti-HOXC4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for HOXC4 purchase

MBS6167889 is an antibody targeting HOXC4. Also known as HOXC4 (Homeobox C4, HOX3, HOX3E, cp19) (APC). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for HOXC4. It may not necessarily be applicable to this product.

NCBI GI #
24497540
NCBI GeneID
3221
NCBI Accession #
NP_705897
UniProt Primary Accession #
P09017
UniProt Related Accession #
P09017
GenBank Nucleotide #
NM_153633
NCBI Official Full Name
homeobox protein Hox-C4
NCBI Official Synonym Full Names
homeobox C4
NCBI Official Symbol
HOXC4
NCBI Official Synonym Symbols
HOX3; cp19; HOX3E
UniProt Protein Name
Homeobox protein Hox-C4
UniProt Synonym Protein Names
Homeobox protein CP19; Homeobox protein Hox-3E
Protein Family
Homeobox protein
UniProt Gene Name
HOXC4
UniProt Synonym Gene Names
HOX3E
UniProt Entry Name
HXC4_HUMAN
NCBI Protein Information
homeobox protein Hox-C4

UniProt Comments for HOXC4

HOXC4: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Belongs to the Antp homeobox family. Deformed subfamily.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: anterior/posterior pattern formation; cartilage development; embryonic organ morphogenesis; regulation of transcription, DNA-dependent; transcription, DNA-dependent
Show more

Research Articles on HOXC4

1. HOXC4 homeoprotein expands human hematopoietic immature cells by 3 to 6 times ex vivo and significantly improves the level of in vivo engraftment.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-HOXC4 antibody

 Reference Product  PubMed Publications
 XRCC5 antibody  >2 publications with HOXC4 and XRCC5
 POU2F1 antibody  >2 publications with HOXC4 and POU2F1
 PRKDC antibody  >1 publications with HOXC4 and PRKDC

Diseases associated with anti-HOXC4 antibody

 Disease Name  Pubmed Publications
 Neoplasms Antibodies  >12 publications with HOXC4 and Neoplasms
 Skin Neoplasms Antibodies  >3 publications with HOXC4 and Skin Neoplasms
 Carcinoma Antibodies  >2 publications with HOXC4 and Carcinoma
 Congenital Abnormalities Antibodies  >2 publications with HOXC4 and Congenital Abnormalities
 Heart Diseases Antibodies  >1 publications with HOXC4 and Heart Diseases
 Nervous System Diseases Antibodies  >1 publications with HOXC4 and Nervous System Diseases
 Cardiovascular Abnormalities Antibodies  >1 publications with HOXC4 and Cardiovascular Abnormalities
 Heart Defects, Congenital Antibodies  >1 publications with HOXC4 and Heart Defects, Congenital
 Inflammation Antibodies  >1 publications with HOXC4 and Inflammation
 Necrosis Antibodies  >1 publications with HOXC4 and Necrosis

Organs/Tissues associated with anti-HOXC4 antibody

 Organ/Tissue Name  Pubmed Publications
 Bone Antibodies  >10 publications with HOXC4 and Bone
 Embryonic Tissue Antibodies  >9 publications with HOXC4 and Embryonic Tissue
 Skin Antibodies  >8 publications with HOXC4 and Skin
 Lymph Node Antibodies  >5 publications with HOXC4 and Lymph Node
 Connective Tissue Antibodies  >3 publications with HOXC4 and Connective Tissue
 Brain Antibodies  >3 publications with HOXC4 and Brain
 Heart Antibodies  >3 publications with HOXC4 and Heart
 Muscle Antibodies  >2 publications with HOXC4 and Muscle
 Stomach Antibodies  >2 publications with HOXC4 and Stomach
 Lung Antibodies  >2 publications with HOXC4 and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000