• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ARHGEF9 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6174309

ARHGEF9 belongs to a family of Rho-like GTPases that act as molecular switches by cycling from the active GTP-bound state to the inactive GDP-bound state. These proteins are key regulators of the actin cytoskeleton and are involved in cell signaling.… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ARHGEF9, Monoclonal Antibody
Full Product Name
ARHGEF9 (Cdc42 Guanine Nucleotide Exchange Factor (GEF) 9, COLLYBISTIN, HPEM-2, KIAA0424, PEM-2, PEM2) (Biotin)
Product Gene Name
anti-ARHGEF9 antibody
Product Synonym Names
Cdc42 Guanine Nucleotide Exchange Factor (GEF) 9; COLLYBISTIN; HPEM-2; KIAA0424; PEM-2; PEM2
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C11
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Purity/Purification
Purified
Specificity
Recognizes ARHGEF9.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molecular Weight
49,458 Da
OMIM
300429
3D Structure
ModBase 3D Structure for O43307
Immunogen
ARHGEF9 (NP_056000.1, 419aa-516aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AFREERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Conjugate
Biotin

Product Categories/Family for anti-ARHGEF9 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins
Applications Tested/Suitable for anti-ARHGEF9 antibody
Western Blot (WB)
Application Notes for anti-ARHGEF9 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-ARHGEF9 antibody

ARHGEF9 monoclonal antibody (M01), clone 3C11. Western Blot analysis of ARHGEF9 expression in MCF-7.
Mouse Anti-ARHGEF9 Monoclonal Antibody – Cat# MBS6174309

Testing Data of anti-ARHGEF9 antibody

Detection limit for recombinant GST tagged ARHGEF9 is 3 ng/ml as a capture antibody.
Mouse Anti-ARHGEF9 Monoclonal Antibody, Testing Data – Cat# MBS6174309

Other Notes

Small volumes of anti-ARHGEF9 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ARHGEF9 purchase

MBS6174309 is an antibody targeting ARHGEF9. Also known as ARHGEF9 (Cdc42 Guanine Nucleotide Exchange Factor (GEF) 9, COLLYBISTIN, HPEM-2, KIAA0424, PEM-2, PEM2) (Biotin). Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ARHGEF9. It may not necessarily be applicable to this product.

NCBI GI #
7662108
NCBI GeneID
23229
NCBI Accession #
NP_056000.1
UniProt Primary Accession #
O43307
UniProt Secondary Accession #
Q5JSL6; A8K1S8; B4DHC7; F8W7P8
UniProt Related Accession #
O43307
GenBank Nucleotide #
NM_015185.2
NCBI Official Full Name
rho guanine nucleotide exchange factor 9 isoform 1
NCBI Official Synonym Full Names
Cdc42 guanine nucleotide exchange factor (GEF) 9
NCBI Official Symbol
ARHGEF9
NCBI Official Synonym Symbols
PEM2; EIEE8; PEM-2; HPEM-2; COLLYBISTIN
UniProt Protein Name
Rho guanine nucleotide exchange factor 9
UniProt Synonym Protein Names
Collybistin; PEM-2 homolog; Rac/Cdc42 guanine nucleotide exchange factor 9
Protein Family
Rho guanine nucleotide exchange factor
UniProt Gene Name
ARHGEF9
UniProt Synonym Gene Names
ARHDH9; KIAA0424
UniProt Entry Name
ARHG9_HUMAN
NCBI Protein Information
rho guanine nucleotide exchange factor 9; PEM-2 homolog; hPEM-2 collybistin; rac/Cdc42 guanine nucleotide exchange factor 9

NCBI Summary for ARHGEF9

The protein encoded by this gene is a Rho-like GTPase that switches between the active (GTP-bound) state and inactive (GDP-bound) state to regulate CDC42 and other genes. Defects in this gene are a cause of startle disease with epilepsy (STHEE), also known as hyperekplexia with epilepsy. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2010]
Show more

UniProt Comments for ARHGEF9

ARHGEF9: Acts as guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters. Defects in ARHGEF9 are the cause of pileptic encephalopathy, early infantile, type 8 (EIEE8). A disorder characterized by hyperekplexia and early infantile epileptic encephalopathy. Neurologic features include exaggerated startle response, seizures, impaired psychomotor development, and mental retardation. Seizures can be provoked by tactile stimulation or extreme emotion. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs; GAPs, Rac/Rho

Chromosomal Location of Human Ortholog: Xq11.1

Cellular Component: cytoplasm; cytosol

Molecular Function: Rho guanyl-nucleotide exchange factor activity

Biological Process: synaptic transmission; regulation of small GTPase mediated signal transduction; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; small GTPase mediated signal transduction; transmembrane transport

Disease: Epileptic Encephalopathy, Early Infantile, 8
Show more

Research Articles on ARHGEF9

1. The enhancement of Cb-induced gephyrin clustering by GTP-TC10 does not depend on the guanine nucleotide exchange activity of Cb but involves an interaction that resembles reported interactions of other small GTPases with their effectors

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-ARHGEF9 antibody

 Reference Product  PubMed Publications
 CDC42 antibody  >12 publications with ARHGEF9 and CDC42
 GPHN antibody  >6 publications with ARHGEF9 and GPHN
 OPHN1 antibody  >1 publications with ARHGEF9 and OPHN1

Pathways associated with anti-ARHGEF9 antibody

 Products by Pathway  Pathway Diagram
 Cell Death Signalling Via NRAGE, NRIF And NADE Pathway antibodies  Cell Death Signalling Via NRAGE, NRIF And NADE Pathway Diagram
 G Alpha (12/13) Signalling Events Pathway antibodies  G Alpha (12/13) Signalling Events Pathway Diagram
 GABA A Receptor Activation Pathway antibodies  GABA A Receptor Activation Pathway Diagram
 GABA Receptor Activation Pathway antibodies  GABA Receptor Activation Pathway Diagram
 GPCR Downstream Signaling Pathway antibodies  GPCR Downstream Signaling Pathway Diagram
 Ion Channel Transport Pathway antibodies  Ion Channel Transport Pathway Diagram
 Ligand-gated Ion Channel Transport Pathway antibodies  Ligand-gated Ion Channel Transport Pathway Diagram
 NRAGE Signals Death Through JNK Pathway antibodies  NRAGE Signals Death Through JNK Pathway Diagram
 Neuronal System Pathway antibodies  Neuronal System Pathway Diagram
 Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell Pathway antibodies  Neurotransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell Pathway Diagram

Diseases associated with anti-ARHGEF9 antibody

 Disease Name  Pubmed Publications
 Nervous System Diseases Antibodies  >14 publications with ARHGEF9 and Nervous System Diseases
 Neurobehavioral Manifestations Antibodies  >8 publications with ARHGEF9 and Neurobehavioral Manifestations
 Mental Disorders Antibodies  >7 publications with ARHGEF9 and Mental Disorders
 Congenital Abnormalities Antibodies  >4 publications with ARHGEF9 and Congenital Abnormalities
 Mental Retardation, X-Linked Antibodies  >4 publications with ARHGEF9 and Mental Retardation, X-Linked
 Carcinoma, Hepatocellular Antibodies  >2 publications with ARHGEF9 and Carcinoma, Hepatocellular
 Liver Neoplasms Antibodies  >2 publications with ARHGEF9 and Liver Neoplasms
 Hyperekplexia and Epilepsy Antibodies  >2 publications with ARHGEF9 and Hyperekplexia and Epilepsy
 Immune System Diseases Antibodies  >1 publications with ARHGEF9 and Immune System Diseases
 Heart Defects, Congenital Antibodies  >1 publications with ARHGEF9 and Heart Defects, Congenital

Organs/Tissues associated with anti-ARHGEF9 antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >21 publications with ARHGEF9 and Brain
 Blood Antibodies  >2 publications with ARHGEF9 and Blood
 Muscle Antibodies  >2 publications with ARHGEF9 and Muscle
 Liver Antibodies  >2 publications with ARHGEF9 and Liver
 Embryonic Tissue Antibodies  >2 publications with ARHGEF9 and Embryonic Tissue
 Heart Antibodies  >1 publications with ARHGEF9 and Heart
 Bone Antibodies  >1 publications with ARHGEF9 and Bone
 Lung Antibodies  >1 publications with ARHGEF9 and Lung
 Skin Antibodies  >1 publications with ARHGEF9 and Skin
 Eye Antibodies  >1 publications with ARHGEF9 and Eye
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000