• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

DHX9 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6189796

MBS6189796 is an antibody targeting DHX9. Also known as DHX9 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 9, DEAH Box Protein 9, DHX-9, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9, DDX9, DDX-9, ATP-dependent RNA Helicase A, LKP, Nuclear DNA Helicase II, NDHII,… More details

$960 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
DHX9, Monoclonal Antibody
Full Product Name
DHX9 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 9, DEAH Box Protein 9, DHX-9, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9, DDX9, DDX-9, ATP-dependent RNA Helicase A, LKP, Nuclear DNA Helicase II, NDHII, NDH2, RNA Helicase A, RHA) (MaxLight 405)
Product Gene Name
anti-DHX9 antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G7
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human DHX9.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
141kDa
OMIM
603115
3D Structure
ModBase 3D Structure for Q08211
Immunogen
Partial recombinant corresponding to aa1-90 from human DHX9 (NP_001348) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP
Conjugate
MaxLight405

Product Categories/Family for anti-DHX9 antibody

Antibodies; DEAD Box Proteins
Applications Tested/Suitable for anti-DHX9 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes for anti-DHX9 antibody
IF: 10ug/ml
FLISA: The detection limit is ~3ng/ml as a capture antibody
Applications are based on unconjugated antibody.

Product References and Citations for anti-DHX9 antibody

1. Coordinate roles of Gag and RNA helicase A in promoting the annealing of tRNALys3 to HIV-1 RNA. Xing L, Liang C, Kleiman L.J Virol. 2010 Nov 24. 2.Functional proteomic analysis of promyelocytic leukaemia nuclear bodies in irradiation-induced MCF-7 cells. Liu J, Song Y, Tian B, Qian J, Dong Y, Liu J, Liu B, Sun Z.J Biochem. 2010 Dec;148(6):659-67. Epub 2010 Sep 7. 3. RNA Helicase A Interacts with RISC in Human Cells and Functions in RISC Loading. Robb GB, Rana TM.Mol Cell. 2007 May 25;26(4):523-37.

Other Notes

Small volumes of anti-DHX9 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for DHX9. It may not necessarily be applicable to this product.

NCBI GI #
100913206
NCBI GeneID
1660
NCBI Accession #
NP_001348
UniProt Primary Accession #
Q08211
UniProt Related Accession #
Q08211
GenBank Nucleotide #
NM_001357
NCBI Official Full Name
ATP-dependent RNA helicase A
NCBI Official Synonym Full Names
DExH-box helicase 9
NCBI Official Symbol
DHX9
NCBI Official Synonym Symbols
LKP; RHA; DDX9; NDH2; NDHII
UniProt Protein Name
ATP-dependent RNA helicase A
UniProt Synonym Protein Names
DEAH box protein 9; Leukophysin; LKP; Nuclear DNA helicase II; NDH II
Protein Family
ATP-dependent RNA helicase
UniProt Gene Name
DHX9
UniProt Synonym Gene Names
DDX9; LKP; NDH2; RHA; LKP; NDH II
UniProt Entry Name
DHX9_HUMAN
NCBI Protein Information
ATP-dependent RNA helicase A

NCBI Summary for DHX9

This gene encodes a member of the DEAH-containing family of RNA helicases. The encoded protein is an enzyme that catalyzes the ATP-dependent unwinding of double-stranded RNA and DNA-RNA complexes. This protein localizes to both the nucleus and the cytoplasm and functions as a transcriptional regulator. This protein may also be involved in the expression and nuclear export of retroviral RNAs. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 11 and 13.[provided by RefSeq, Feb 2010]
Show more

UniProt Comments for DHX9

DDX9: a helicase that unwinds double-stranded DNA and RNA in a 3' to 5' direction. Interacts with the RNA-induced silencing complex (RISC) in human cells and functions in RISC loading. Generates multiple secondary structures that influence RNA-binding proteins. Has a dsRNA binding motif at the N-terminus, RGG-box at the carboxyl terminus, and a bidirectional nuclear transport domain of 110 amino acids at the carboxyl terminus. May play a role in X-linked gene expression.

Protein type: Nuclear receptor co-regulator; Spliceosome; Nucleolus; Helicase; RNA splicing; EC 3.6.4.13; RNA-binding; RNA processing

Chromosomal Location of Human Ortholog: 1q25

Cellular Component: nucleoplasm; centrosome; membrane; cytoplasm; nucleolus; nucleus; ribonucleoprotein complex; cytosol

Molecular Function: ATP-dependent DNA helicase activity; protein binding; DNA binding; ATP-dependent RNA helicase activity; ATP binding; RNA helicase activity

Biological Process: osteoblast differentiation; circadian rhythm; RNA processing; nuclear mRNA splicing, via spliceosome; RNA splicing; positive regulation of interferon type I production; innate immune response; gene expression; DNA duplex unwinding
Show more

Research Articles on DHX9

1. DHX9 (RNA helicase A) promotes the formation of pathological and non-pathological R-loops.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-DHX9 antibody

 Reference Product  PubMed Publications
 BRCA1 antibody  >3 publications with DHX9 and BRCA1
 NXF1 antibody  >2 publications with DHX9 and NXF1
 DDX20 antibody  >2 publications with DHX9 and DDX20
 AKAP8L antibody  >2 publications with DHX9 and AKAP8L
 PRMT1 antibody  >1 publications with DHX9 and PRMT1
 PCNA antibody  >1 publications with DHX9 and PCNA

Pathways associated with anti-DHX9 antibody

 Products by Pathway  Pathway Diagram
 Formation And Maturation Of MRNA Transcript Pathway antibodies  Formation And Maturation Of MRNA Transcript Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Processing Of Capped Intron-Containing Pre-mRNA Pathway antibodies  Processing Of Capped Intron-Containing Pre-mRNA Pathway Diagram
 MRNA Processing Pathway antibodies  MRNA Processing Pathway Diagram
 MRNA Splicing Pathway antibodies  MRNA Splicing Pathway Diagram
 MRNA Splicing - Major Pathway antibodies  MRNA Splicing - Major Pathway Diagram
 MRNA Processing Pathway antibodies  MRNA Processing Pathway Diagram

Diseases associated with anti-DHX9 antibody

 Disease Name  Pubmed Publications
 Leukemia Antibodies  >3 publications with DHX9 and Leukemia
 Breast Neoplasms Antibodies  >3 publications with DHX9 and Breast Neoplasms
 Lung Neoplasms Antibodies  >2 publications with DHX9 and Lung Neoplasms
 Lung Diseases Antibodies  >2 publications with DHX9 and Lung Diseases
 Skin Diseases Antibodies  >2 publications with DHX9 and Skin Diseases
 Neurodegenerative Diseases Antibodies  >1 publications with DHX9 and Neurodegenerative Diseases
 Lymphoma Antibodies  >1 publications with DHX9 and Lymphoma
 Leukemia, Myeloid Antibodies  >1 publications with DHX9 and Leukemia, Myeloid
 Hematologic Diseases Antibodies  >1 publications with DHX9 and Hematologic Diseases
 Atrophy Antibodies  >1 publications with DHX9 and Atrophy

Organs/Tissues associated with anti-DHX9 antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >7 publications with DHX9 and Blood
 Kidney Antibodies  >2 publications with DHX9 and Kidney
 Bone Antibodies  >2 publications with DHX9 and Bone
 Lung Antibodies  >2 publications with DHX9 and Lung
 Brain Antibodies  >2 publications with DHX9 and Brain
 Lymph Antibodies  >1 publications with DHX9 and Lymph
 Lymph Node Antibodies  >1 publications with DHX9 and Lymph Node
 Prostate Antibodies  >1 publications with DHX9 and Prostate
 Thymus Antibodies  >1 publications with DHX9 and Thymus
 Intestine Antibodies  >1 publications with DHX9 and Intestine
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000