Mouse Anti-KLK13 Monoclonal Antibody – Cat# MBS6190812

Kallikrein 13 (KLK13) Antibody – Mouse Monoclonal

Name: KLK13 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6190812
Price: 960 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6190812

$960 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

Kallikrein 13 (KLK13), Monoclonal Antibody

Full Product Name

Kallikrein 13 (KLK13, Kallikrein-related Peptidase 13, Kallikrein-like Protein 4, KLKL4, KLK-L4, DKFZp586J1923) (MaxLight 405)

Product Gene Name

anti-KLK13 antibody

Clonality

Monoclonal

Isotype

IgG2b,k

Clone Number

1G9

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human KLK13.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

31.3 kDa (284aa)

OMIM

605505

3D Structure

ModBase 3D Structure for Q9UKR3

Immunogen

Partial recombinant corresponding to aa179-278 from human KLK13 (NP_056411) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

ANIQLRSDEECRQVYPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ*

Conjugate

MaxLight405

Product Categories/Family for anti-KLK13 antibody

Antibodies; Kallikrein

Applications Tested/Suitable for anti-KLK13 antibody

FLISA, Western Blot (WB)

Application Notes for anti-KLK13 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-KLK13 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for KLK13 purchase

MBS6190812 is an antibody targeting KLK13. Also known as Kallikrein 13 (KLK13, Kallikrein-related Peptidase 13, Kallikrein-like Protein 4, KLKL4, KLK-L4, DKFZp586J1923) (MaxLight 405). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for KLK13. It may not necessarily be applicable to this product.

NCBI GI #

11496281

NCBI GeneID

26085

NCBI Accession #

NP_056411

UniProt Primary Accession #

Q9UKR3

UniProt Secondary Accession #

Q86VI8; Q9Y433; A7UNK6

UniProt Related Accession #

Q9UKR3

GenBank Nucleotide #

NM_015596

NCBI Official Full Name

kallikrein-13 isoform 1

NCBI Official Synonym Full Names

kallikrein related peptidase 13

NCBI Official Symbol

KLK13

NCBI Official Synonym Symbols

KLKL4; KLK-L4

UniProt Protein Name

Kallikrein-13

UniProt Synonym Protein Names

Kallikrein-like protein 4; KLK-L4

Protein Family

Kallikrein

UniProt Gene Name

KLK13

UniProt Synonym Gene Names

KLKL4; KLK-L4

UniProt Entry Name

KLK13_HUMAN

NCBI Protein Information

kallikrein-13

NCBI Summary for KLK13

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. [provided by RefSeq, Jan 2017]

UniProt Comments for KLK13

KLK13: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Expression of this gene is regulated by steroid hormones and may be useful as a marker for breast cancer. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq, Jul 2008]

Protein type: EC 3.4.21.-; Protease; Secreted; Secreted, signal peptide; Vesicle

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: cytoplasm; extracellular region; extracellular space

Molecular Function: hydrolase activity; protein binding; serine-type endopeptidase activity

Biological Process: protein processing

Research Articles on KLK13

1. This first clinical study of KLK13 in bladder cancer reveals its deregulated expression in bladder tumors and highlights KLK13 as a promising marker for improving TaT1 patients' prognosis following treatment.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-KLK13 antibody

Reference Product	PubMed Publications
A2M antibody	>1 publications with KLK13 and A2M

Pathways associated with anti-KLK13 antibody

Products by Pathway	Pathway Diagram
Developmental Biology Pathway antibodies	Developmental Biology Pathway Diagram
Formation Of The Cornified Envelope Pathway antibodies	Formation Of The Cornified Envelope Pathway Diagram
Keratinization Pathway antibodies	Keratinization Pathway Diagram
Metabolism Of Proteins Pathway antibodies	Metabolism Of Proteins Pathway Diagram
Regulation Of Insulin-like Growth Factor (IGF) Transport And Uptake By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway antibodies	Regulation Of Insulin-like Growth Factor (IGF) Transport And Uptake By Insulin-like Growth Factor Binding Proteins (IGFBPs) Pathway Diagram

Diseases associated with anti-KLK13 antibody

Disease Name	Pubmed Publications
Breast Neoplasms Antibodies	>9 publications with KLK13 and Breast Neoplasms
Lung Neoplasms Antibodies	>7 publications with KLK13 and Lung Neoplasms
Ovarian Diseases Antibodies	>6 publications with KLK13 and Ovarian Diseases
Lung Diseases Antibodies	>6 publications with KLK13 and Lung Diseases
Immune System Diseases Antibodies	>4 publications with KLK13 and Immune System Diseases
Death Antibodies	>4 publications with KLK13 and Death
Inflammation Antibodies	>2 publications with KLK13 and Inflammation
Birth Weight Antibodies	>1 publications with KLK13 and Birth Weight
Neoplasms, Experimental Antibodies	>1 publications with KLK13 and Neoplasms, Experimental
Infertility, Male Antibodies	>1 publications with KLK13 and Infertility, Male

Organs/Tissues associated with anti-KLK13 antibody

Organ/Tissue Name	Pubmed Publications
Mouth Antibodies	>11 publications with KLK13 and Mouth
Testis Antibodies	>5 publications with KLK13 and Testis
Uncharacterized Tissue Antibodies	>1 publications with KLK13 and Uncharacterized Tissue