• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

RGCC Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6192265

C13orf15 is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during… More details

$960 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
RGCC, Monoclonal Antibody
Full Product Name
RGCC (C13orf15, RGC32, Regulator of Cell Cycle RGCC, Response Gene to Complement 32 Protein) (MaxLight 405)
Product Gene Name
anti-RGCC antibody
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B9
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human RGCC.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
15kDa
OMIM
AF036549 mRNA
3D Structure
ModBase 3D Structure for Q9H4X1
Immunogen
Partial recombinant protein corresponding to aa1-117 from human RGCC with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKPPAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERMKRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDTKELEAFIADLDKTLASM*
Conjugate
MaxLight405

Product Categories/Family for anti-RGCC antibody

Antibodies; Complement
Applications Tested/Suitable for anti-RGCC antibody
FLISA, Immunofluorescence (IF)
Application Notes for anti-RGCC antibody
Applications are based on unconjugated antibody.

Testing Data of anti-RGCC antibody

Detection limit is 0.03ng/ml using MBS6073576 as a capture antibody.
Mouse Anti-RGCC Monoclonal Antibody – Cat# MBS6192265

Immunofluorescence (IF) of anti-RGCC antibody

Immunofluorescence of C13orf15 on HeLa cells using MBS6073576 (10ug/ml).
Mouse Anti-RGCC Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6192265

Other Notes

Small volumes of anti-RGCC antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for RGCC purchase

MBS6192265 is an antibody targeting RGCC. Also known as RGCC (C13orf15, RGC32, Regulator of Cell Cycle RGCC, Response Gene to Complement 32 Protein) (MaxLight 405). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for RGCC. It may not necessarily be applicable to this product.

NCBI GI #
132626811
NCBI GeneID
28984
NCBI Accession #
NP_054778
UniProt Primary Accession #
Q9H4X1
UniProt Related Accession #
Q9H4X1
GenBank Nucleotide #
NM_014059
NCBI Official Full Name
regulator of cell cycle RGCC
NCBI Official Synonym Full Names
regulator of cell cycle
NCBI Official Symbol
RGCC
NCBI Official Synonym Symbols
RGC32; RGC-32; C13orf15; bA157L14.2
UniProt Protein Name
Regulator of cell cycle RGCC
UniProt Synonym Protein Names
Response gene to complement 32 protein; RGC-32
Protein Family
Regulator of cell cycle
UniProt Gene Name
RGCC
UniProt Synonym Gene Names
C13orf15; RGC32; RGC-32
NCBI Protein Information
regulator of cell cycle RGCC

NCBI Summary for RGCC

This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during interphase and to centrosomes during mitosis. The protein forms a complex with polo-like kinase 1. The protein also translocates to the nucleus in response to treatment with complement system proteins, and can associate with and increase the kinase activity of cell division cycle 2 protein. In different assays and cell types, overexpression of this protein has been shown to activate or suppress cell cycle progression. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for RGCC

Modulates the activity of cell cycle-specific kinases. Enhances CDK1 activity. May contribute to the regulation of the cell cycle. May inhibit growth of glioma cells by promoting arrest of mitotic progression at the G2/M transition. Fibrogenic factor contributing to the pathogenesis of renal fibrosis through fibroblast activation.
Show more

Research Articles on RGCC

1. RGC32 facilitates epithelial-mesenchymal transition of colorectal cancer cells by activating Smad/Sip1 signaling.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-RGCC antibody

 Reference Product  PubMed Publications
 CDK1 antibody  >1 publications with RGCC and CDK1

Pathways associated with anti-RGCC antibody

 Products by Pathway  Pathway Diagram
 Direct P53 Effectors Pathway antibodies  Direct P53 Effectors Pathway Diagram
 Gene Expression Pathway antibodies  Gene Expression Pathway Diagram
 Generic Transcription Pathway antibodies  Generic Transcription Pathway Diagram
 TP53 Regulates Transcription Of Cell Cycle Genes Pathway antibodies  TP53 Regulates Transcription Of Cell Cycle Genes Pathway Diagram
 TP53 Regulates Transcription Of Additional Cell Cycle Genes Whose Exact Role In The P53 Pathway Remain Uncertain antibodies  TP53 Regulates Transcription Of Additional Cell Cycle Genes Whose Exact Role In The P53 Pathway Remain Uncertain Diagram
 Transcriptional Regulation By TP53 Pathway antibodies  Transcriptional Regulation By TP53 Pathway Diagram

Diseases associated with anti-RGCC antibody

 Disease Name  Pubmed Publications
 Lung Diseases Antibodies  >1 publications with RGCC and Lung Diseases
 Hypertension Antibodies  >1 publications with RGCC and Hypertension
 Breast Neoplasms Antibodies  >1 publications with RGCC and Breast Neoplasms
 Disease Models, Animal Antibodies  >1 publications with RGCC and Disease Models, Animal
 Cardiovascular Diseases Antibodies  >1 publications with RGCC and Cardiovascular Diseases
 Lung Neoplasms Antibodies  >1 publications with RGCC and Lung Neoplasms
 Inflammation Antibodies  >1 publications with RGCC and Inflammation

Organs/Tissues associated with anti-RGCC antibody

 Organ/Tissue Name  Pubmed Publications
 Blood Antibodies  >2 publications with RGCC and Blood
 Bone Antibodies  >1 publications with RGCC and Bone
 Connective Tissue Antibodies  >1 publications with RGCC and Connective Tissue
 Eye Antibodies  >1 publications with RGCC and Eye
 Nerve Antibodies  >1 publications with RGCC and Nerve
 Lung Antibodies  >1 publications with RGCC and Lung
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000