Mouse Anti-ARF5 Monoclonal Antibody – Cat# MBS6199578

ARF5 Antibody – Mouse Monoclonal

Name: ARF5 Antibody; Monoclonal; Mouse; Human/Mouse/Rat-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6199578
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6199578

MBS6199578 is an antibody targeting ARF5. Also known as ARF5 (ADP-ribosylation Factor 5) (MaxLight 490). Reactive in Human, Mouse, Rat. Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ARF5, Monoclonal Antibody

Full Product Name

ARF5 (ADP-ribosylation Factor 5) (MaxLight 490)

Product Gene Name

anti-ARF5 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

1B4

Host

Mouse

Species Reactivity

Human, Mouse, Rat

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human ARF5. Species Crossreactivity: mouse and rat.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

20,530 Da

OMIM

103188

3D Structure

ModBase 3D Structure for P84085

Immunogen

Partial recombinant corresponding to aa81-180 from human ARF5 (AAH03043) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR

Conjugate

MaxLight490

Product Categories/Family for anti-ARF5 antibody

Antibodies; Transport Proteins

Applications Tested/Suitable for anti-ARF5 antibody

FLISA, Immunofluorescence (IF), Western Blot (WB)

Application Notes for anti-ARF5 antibody

IF: 15ug/ml
Applications are based on unconjugated antibody.

Product References and Citations for anti-ARF5 antibody

1. GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis. Takashima K, Saitoh A, Hirose S, Nakai W, Kondo Y, Takasu Y, Kakeya H, Shin HW, Nakayama K.Cell Struct Funct. 2011;36(2):223-35. 2. Class II ADP-Ribosylation factors are required for efficient secretion of dengue viruses. Kudelko M, Brault JB, Kwok K, Li MY, Pardigon N, Peiris JS, Bruzzone R, Despres P, Nal B, Wang PG.J Biol Chem. 2011 Nov 21. 3. Interaction of phosphodiesterase 3A with brefeldin A-inhibited guanine nucleotide-exchange proteins BIG1 and BIG2 and effect on ARF1 activity. Puxeddu E, Uhart M, Li CC, Ahmad F, Pacheco-Rodriguez G, Manganiello VC, Moss J, Vaughan M.Proc Natl Acad Sci U S A. 2009 Apr 14;106(15):6158-63. Epub 2009 Mar 30. 4. EFA6 facilitates the assembly of the tight junction by coordinating an Arf6-dependent and independent pathway. Klein S, Partisani M, Franco M, Luton F.J Biol Chem. 2008 Oct 31;283(44):30129-38. Epub 2008 Sep 8. 5. The brefeldin A-inhibited guanine nucleotide-exchange protein, BIG2, regulates the constitutive release of TNFR1 exosome-like vesicles. Islam A, Shen X, Hiroi T, Moss J, Vaughan M, Levine SJ.J Biol Chem. 2007 Mar 30;282(13):9591-9. Epub 2007 Feb 2.

Other Notes

Small volumes of anti-ARF5 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ARF5. It may not necessarily be applicable to this product.

NCBI GI #

12804364

NCBI GeneID

381

NCBI Accession #

BC003043

NCBI Related Accession #

AAH03043

UniProt Primary Accession #

P84085

UniProt Secondary Accession #

P26437

UniProt Related Accession #

P84085

NCBI Official Full Name

Homo sapiens ADP-ribosylation factor 5, mRNA

NCBI Official Synonym Full Names

ADP ribosylation factor 5

NCBI Official Symbol

ARF5

UniProt Protein Name

ADP-ribosylation factor 5

Protein Family

ADP-ribosylation factor

UniProt Gene Name

ARF5

UniProt Entry Name

ARF5_HUMAN

NCBI Protein Information

ADP-ribosylation factor 5

NCBI Summary for ARF5

This gene is a member of the human ADP-ribosylation factor (ARF) gene family. These genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The gene products include 6 ARF proteins and 11 ARF-like proteins and constitute 1 family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2,and ARF3), class II (ARF4 and ARF5) and class III (ARF6). The members of each class share a common gene organization. [provided by RefSeq, Dec 2010]

UniProt Comments for ARF5

ARF5: GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP- ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus. Belongs to the small GTPase superfamily. Arf family.

Protein type: G protein, monomeric, ARF; G protein; G protein, monomeric; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 7q31.3

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; plasma membrane

Molecular Function: GTPase activity; protein binding; GTP binding

Biological Process: vesicle-mediated transport; protein transport; metabolic process; small GTPase mediated signal transduction

Research Articles on ARF5

1. GORAB missense mutation disrupt ARF5 binding in Golgi apparatus in patients, with genetic skin diseases.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-ARF5 antibody

Products by Pathway	Pathway Diagram
Class I PI3K Signaling Events Pathway antibodies	Class I PI3K Signaling Events Pathway Diagram

Diseases associated with anti-ARF5 antibody

Disease Name	Pubmed Publications
Neoplasm Metastasis Antibodies	>1 publications with ARF5 and Neoplasm Metastasis
Death Antibodies	>1 publications with ARF5 and Death
Edema Antibodies	>1 publications with ARF5 and Edema
Hypertrophy Antibodies	>1 publications with ARF5 and Hypertrophy

Organs/Tissues associated with anti-ARF5 antibody

Organ/Tissue Name	Pubmed Publications
Brain Antibodies	>14 publications with ARF5 and Brain
Heart Antibodies	>10 publications with ARF5 and Heart
Blood Antibodies	>8 publications with ARF5 and Blood
Lung Antibodies	>7 publications with ARF5 and Lung
Nerve Antibodies	>7 publications with ARF5 and Nerve
Kidney Antibodies	>4 publications with ARF5 and Kidney
Muscle Antibodies	>4 publications with ARF5 and Muscle
Spleen Antibodies	>3 publications with ARF5 and Spleen
Liver Antibodies	>3 publications with ARF5 and Liver
Pancreas Antibodies	>3 publications with ARF5 and Pancreas