Mouse Anti-CABIN1 Monoclonal Antibody – Cat# MBS6199848

CABIN1 Antibody – Mouse Monoclonal

Name: CABIN1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6199848
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6199848

Calcineurin is a widely distributed Ser/Thr, calcium and calmodulin-dependent protein phosphatase. It mediates the immunosuppressive actions of drugs such as FK506 and cyclosporin, and has also been implicated in a number of calcium-sensitive pathways in the… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CABIN1, Monoclonal Antibody

Full Product Name

CABIN1 (Calcineurin-binding Protein Cabin-1, Calcineurin Inhibitor, CAIN, KIAA0330) (MaxLight 490)

Product Gene Name

anti-CABIN1 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2G2

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human CABIN1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

237,574 Da

OMIM

604251

3D Structure

ModBase 3D Structure for Q9Y6J0

Immunogen

Partial recombinant corresponding to aa1-111 from CABIN1 (NP_036427) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYHELLEASLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAM*

Conjugate

MaxLight490

Product Categories/Family for anti-CABIN1 antibody

Antibodies; Signal Transduction

Applications Tested/Suitable for anti-CABIN1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-CABIN1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CABIN1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for CABIN1 purchase

MBS6199848 is an antibody targeting CABIN1. Also known as CABIN1 (Calcineurin-binding Protein Cabin-1, Calcineurin Inhibitor, CAIN, KIAA0330) (MaxLight 490). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for CABIN1. It may not necessarily be applicable to this product.

NCBI GI #

6912458

NCBI GeneID

23523

NCBI Accession #

NP_036427

UniProt Primary Accession #

Q9Y6J0

UniProt Secondary Accession #

Q6PHY0; Q9Y460; G5E9F3

UniProt Related Accession #

Q9Y6J0

GenBank Nucleotide #

NM_012295

NCBI Official Full Name

calcineurin-binding protein cabin-1 isoform a

NCBI Official Synonym Full Names

calcineurin binding protein 1

NCBI Official Symbol

CABIN1

NCBI Official Synonym Symbols

CAIN; PPP3IN; KB-318B8.7

UniProt Protein Name

Calcineurin-binding protein cabin-1

UniProt Synonym Protein Names

Calcineurin inhibitor; CAIN

Protein Family

Calcineurin-binding protein

UniProt Gene Name

CABIN1

UniProt Synonym Gene Names

KIAA0330; CAIN

UniProt Entry Name

CABIN_HUMAN

NCBI Protein Information

calcineurin-binding protein cabin-1

NCBI Summary for CABIN1

Calcineurin plays an important role in the T-cell receptor-mediated signal transduction pathway. The protein encoded by this gene binds specifically to the activated form of calcineurin and inhibits calcineurin-mediated signal transduction. The encoded protein is found in the nucleus and contains a leucine zipper domain as well as several PEST motifs, sequences which confer targeted degradation to those proteins which contain them. Alternative splicing results in multiple transcript variants encoding two different isoforms. [provided by RefSeq, Jan 2011]

Research Articles on CABIN1

1. Results indicate an important role for LMP1 and Cabin1 in regulating apoptosis in nasopharyngeal carcinoma cells in response to genotoxic stress.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-CABIN1 antibody

Products by Pathway	Pathway Diagram
Calcium Signaling In The CD4+ TCR Pathway antibodies	Calcium Signaling In The CD4+ TCR Pathway Diagram
Cellular Senescence Pathway antibodies	Cellular Senescence Pathway Diagram
Cellular Responses To Stress Pathway antibodies	Cellular Responses To Stress Pathway Diagram
DNA Damage/Telomere Stress Induced Senescence Pathway antibodies	DNA Damage/Telomere Stress Induced Senescence Pathway Diagram
Formation Of Senescence-Associated Heterochromatin Foci (SAHF) Pathway antibodies	Formation Of Senescence-Associated Heterochromatin Foci (SAHF) Pathway Diagram
Role Of Calcineurin-dependent NFAT Signaling In Lymphocytes Pathway antibodies	Role Of Calcineurin-dependent NFAT Signaling In Lymphocytes Pathway Diagram