Mouse Anti-DUSP1 Monoclonal Antibody – Cat# MBS6211229

DUSP1 Antibody – Mouse Monoclonal

Name: DUSP1 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6211229
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6211229

The expression of DUSP1 gene is induced in human skin fibroblasts by oxidative/heat stress and growth factors. It specifies a protein with structural features similar to members of the non-receptor-type protein-tyrosine phosphatase family, and which has… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

DUSP1, Monoclonal Antibody

Full Product Name

DUSP1 (Dual Specificity Protein Phosphatase 1, CL100, Dual Specificity Protein Phosphatase hVH1, HVH1, Mitogen-activated Protein Kinase Phosphatase 1, MAP Kinase Phosphatase 1, MKP1, MKP-1, Protein-tyrosine Phosphatase CL100, PTPN10, VH1) (MaxLight 550)

Product Gene Name

anti-DUSP1 antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

4H7

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human DUSP1.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

OMIM

600714

3D Structure

ModBase 3D Structure for P28562

Immunogen

Partial recombinant corresponding to aa305-367 from human DUSP1 (NP_004408) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC

Conjugate

MaxLight550

Product Categories/Family for anti-DUSP1 antibody

Antibodies; Enzymes; Phosphatase

Applications Tested/Suitable for anti-DUSP1 antibody

FLISA, Western Blot (WB)

Application Notes for anti-DUSP1 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-DUSP1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for DUSP1 purchase

MBS6211229 is an antibody targeting DUSP1. Also known as DUSP1 (Dual Specificity Protein Phosphatase 1, CL100, Dual Specificity Protein Phosphatase hVH1, HVH1, Mitogen-activated Protein Kinase Phosphatase 1, MAP Kinase Phosphatase 1, MKP1, MKP-1, Protein-tyrosine Phosphatase CL100, PTPN10, VH1) (MaxLight 550). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for DUSP1. It may not necessarily be applicable to this product.

NCBI GI #

4758204

NCBI GeneID

1843

NCBI Accession #

NP_004408

UniProt Primary Accession #

P28562

UniProt Related Accession #

P28562

GenBank Nucleotide #

NM_004417

NCBI Official Full Name

dual specificity protein phosphatase 1

NCBI Official Synonym Full Names

dual specificity phosphatase 1

NCBI Official Symbol

DUSP1

NCBI Official Synonym Symbols

HVH1; MKP1; CL100; MKP-1; PTPN10

UniProt Protein Name

Dual specificity protein phosphatase 1

UniProt Synonym Protein Names

Dual specificity protein phosphatase hVH1; Mitogen-activated protein kinase phosphatase 1; MAP kinase phosphatase 1; MKP-1; Protein-tyrosine phosphatase CL100

Protein Family

Dual specificity protein phosphatase

UniProt Gene Name

DUSP1

UniProt Synonym Gene Names

CL100; MKP1; PTPN10; VH1; MAP kinase phosphatase 1; MKP-1

UniProt Entry Name

DUS1_HUMAN

NCBI Protein Information

dual specificity protein phosphatase 1

NCBI Summary for DUSP1

The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. Finally, the encoded protein can make some solid tumors resistant to both chemotherapy and radiotherapy, making it a target for cancer therapy. [provided by RefSeq, Aug 2017]

UniProt Comments for DUSP1

MKP-1: a non-receptor, dual-specificity phosphoprotein phosphatase (DUSP). Different members of the DUSP family show distinct substrate specificities for MAPKs, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. DUSP1 specifically inactivates mitogen-activated protein (MAP) kinase in vitro by the concomitant dephosphorylation. It is induced in human skin fibroblasts by oxidative/heat stress and growth factors. Contains 1 rhodanese domain.

Protein type: EC 3.1.3.16; Motility/polarity/chemotaxis; EC 3.1.3.48; Protein phosphatase, dual-specificity

Chromosomal Location of Human Ortholog: 5q34

Cellular Component: cytoplasm; nucleus

Molecular Function: protein tyrosine/threonine phosphatase activity; protein binding; protein tyrosine/serine/threonine phosphatase activity; non-membrane spanning protein tyrosine phosphatase activity; MAP kinase tyrosine/serine/threonine phosphatase activity

Biological Process: response to light stimulus; negative regulation of MAP kinase activity; response to cAMP; response to retinoic acid; negative regulation of MAPKKK cascade; positive regulation of apoptosis; response to glucocorticoid stimulus; negative regulation of meiotic cell cycle; response to testosterone stimulus; protein amino acid dephosphorylation; response to estradiol stimulus; cellular response to hormone stimulus; regulation of apoptosis; response to hydrogen peroxide; endoderm formation; response to oxidative stress; response to calcium ion; negative regulation of apoptosis; inactivation of MAPK activity

Research Articles on DUSP1

1. In this pilot study, the expression of GR isoforms and MKP-1 corresponded with patients' clinical response to systemic CS treatment and disease activity, respectively.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-DUSP1 antibody

Reference Product	PubMed Publications
MAPK1 antibody	>115 publications with DUSP1 and MAPK1
MAPK3 antibody	>96 publications with DUSP1 and MAPK3
MAPK8 antibody	>6 publications with DUSP1 and MAPK8
MAPK14 antibody	>5 publications with DUSP1 and MAPK14
MAPK12 antibody	>1 publications with DUSP1 and MAPK12

Pathways associated with anti-DUSP1 antibody

Products by Pathway	Pathway Diagram
ATF-2 Transcription Factor Network Pathway antibodies	ATF-2 Transcription Factor Network Pathway Diagram
Direct P53 Effectors Pathway antibodies	Direct P53 Effectors Pathway Diagram
EGFR1 Signaling Pathway antibodies	EGFR1 Signaling Pathway Diagram
ErbB1 Downstream Signaling Pathway antibodies	ErbB1 Downstream Signaling Pathway Diagram
Fc-epsilon Receptor I Signaling In Mast Cells Pathway antibodies	Fc-epsilon Receptor I Signaling In Mast Cells Pathway Diagram
MAPK Signaling Pathway antibodies	MAPK Signaling Pathway Diagram
MAPK Signaling Pathway antibodies	MAPK Signaling Pathway Diagram
MAPK Signaling Pathway antibodies	MAPK Signaling Pathway Diagram
Regulation Of P38-alpha And P38-beta Pathway antibodies	Regulation Of P38-alpha And P38-beta Pathway Diagram
Serotonergic Synapse Pathway antibodies	Serotonergic Synapse Pathway Diagram

Diseases associated with anti-DUSP1 antibody

Disease Name	Pubmed Publications
Neoplasms Antibodies	>144 publications with DUSP1 and Neoplasms
Inflammation Antibodies	>82 publications with DUSP1 and Inflammation
Necrosis Antibodies	>75 publications with DUSP1 and Necrosis
Cardiovascular Diseases Antibodies	>33 publications with DUSP1 and Cardiovascular Diseases
Lung Diseases Antibodies	>32 publications with DUSP1 and Lung Diseases
Breast Neoplasms Antibodies	>27 publications with DUSP1 and Breast Neoplasms
Nervous System Diseases Antibodies	>27 publications with DUSP1 and Nervous System Diseases
Liver Diseases Antibodies	>27 publications with DUSP1 and Liver Diseases
Neoplasms, Experimental Antibodies	>22 publications with DUSP1 and Neoplasms, Experimental
Hypertension Antibodies	>22 publications with DUSP1 and Hypertension

Organs/Tissues associated with anti-DUSP1 antibody

Organ/Tissue Name	Pubmed Publications
Muscle Antibodies	>81 publications with DUSP1 and Muscle
Blood Antibodies	>80 publications with DUSP1 and Blood
Vascular Antibodies	>67 publications with DUSP1 and Vascular
Brain Antibodies	>63 publications with DUSP1 and Brain
Lung Antibodies	>50 publications with DUSP1 and Lung
Liver Antibodies	>46 publications with DUSP1 and Liver
Bone Antibodies	>41 publications with DUSP1 and Bone
Heart Antibodies	>39 publications with DUSP1 and Heart
Kidney Antibodies	>27 publications with DUSP1 and Kidney
Nerve Antibodies	>27 publications with DUSP1 and Nerve