• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

ITPKB Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6212145

ITPKB regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of this encoded protein is responsible for regulating the levels of a large number of inositol polyphosphates… More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
ITPKB, Monoclonal Antibody
Full Product Name
ITPKB (Inositol-trisphosphate 3-kinase B, Inositol 1,4,5-trisphosphate 3-kinase B, IP3 3-kinase B, IP3K B, InsP 3-kinase B) (MaxLight 550)
Product Gene Name
anti-ITPKB antibody
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2F8
Host
Mouse
Species Reactivity
Human
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Specificity
Recognizes human ITPKB.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Molecular Weight
67,387 Da
OMIM
147522
3D Structure
ModBase 3D Structure for P27987
Immunogen
Partial recombinant corresponding to aa545-643 from human ITPKB (NP_002212) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PELLPQDQDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPR
Conjugate
MaxLight550

Product Categories/Family for anti-ITPKB antibody

Antibodies; Protein Kinases
Applications Tested/Suitable for anti-ITPKB antibody
FLISA, Western Blot (WB)
Application Notes for anti-ITPKB antibody
Applications are based on unconjugated antibody.

Product References and Citations for anti-ITPKB antibody

1. Human inositol-1,4,5-trisphosphate 3-kinase isoform B (IP3KB) is a nucleocytoplasmic shuttling protein specifically enriched at cortical actin filaments and at invaginations of the nuclear envelope. Nalaskowski MM, Fliegert R, Ernst O, Brehm MA, Fanick W, Windhorst S, Lin H, Giehler S, Hein J, Lin YN, Mayr GW.J Biol Chem. 2010 Dec 9.

Other Notes

Small volumes of anti-ITPKB antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for ITPKB purchase

MBS6212145 is an antibody targeting ITPKB. Also known as ITPKB (Inositol-trisphosphate 3-kinase B, Inositol 1,4,5-trisphosphate 3-kinase B, IP3 3-kinase B, IP3K B, InsP 3-kinase B) (MaxLight 550). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for ITPKB. It may not necessarily be applicable to this product.

NCBI GI #
194272161
NCBI GeneID
3707
NCBI Accession #
NP_002212
UniProt Primary Accession #
P27987
UniProt Secondary Accession #
Q5VWL9; Q5VWM0; Q96BZ2; Q96JS1; Q9UH47
UniProt Related Accession #
P27987
GenBank Nucleotide #
NM_002221
NCBI Official Full Name
inositol-trisphosphate 3-kinase B
NCBI Official Synonym Full Names
inositol-trisphosphate 3-kinase B
NCBI Official Symbol
ITPKB
NCBI Official Synonym Symbols
IP3K; IP3KB; PIG37; IP3K-B; IP3-3KB
UniProt Protein Name
Inositol-trisphosphate 3-kinase B
UniProt Synonym Protein Names
Inositol 1,4,5-trisphosphate 3-kinase B
Protein Family
Inositol-trisphosphate 3-kinase
UniProt Gene Name
ITPKB
UniProt Synonym Gene Names
IP3 3-kinase B; IP3K B
UniProt Entry Name
IP3KB_HUMAN
NCBI Protein Information
inositol-trisphosphate 3-kinase B

NCBI Summary for ITPKB

The protein encoded by this protein regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of this encoded protein is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity. [provided by RefSeq, Jul 2008]
Show more

UniProt Comments for ITPKB

ITPKB: The protein encoded by this protein regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins(1,3,4,5)P4. The activity of this encoded protein is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity. [provided by RefSeq, Jul 2008]

Protein type: Motility/polarity/chemotaxis; EC 2.7.1.127; Carbohydrate Metabolism - inositol phosphate; Kinase, lipid

Chromosomal Location of Human Ortholog: 1q42.13

Cellular Component: cytosol

Molecular Function: calmodulin binding; protein binding; inositol trisphosphate 3-kinase activity; ATP binding

Biological Process: cell surface receptor linked signal transduction; inositol phosphate metabolic process; MAPKKK cascade; positive regulation of Ras protein signal transduction; signal transduction; positive regulation of alpha-beta T cell differentiation; positive thymic T cell selection
Show more

Research Articles on ITPKB

1. ITPKB is increased in Alzheimer's brain three-fold in the cerebral cortex of most patients with Alzheimer's disease compared with control subjects and accumulates in dystrophic neurites associated with amyloid plaques.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Pathways associated with anti-ITPKB antibody

 Products by Pathway  Pathway Diagram
 1D-myo-inositol Hexakisphosphate Biosynthesis II (mammalian) Pathway antibodies  1D-myo-inositol Hexakisphosphate Biosynthesis II (mammalian) Pathway Diagram
 1D-myo-inositol Hexakisphosphate Biosynthesis II (mammalian) Pathway antibodies  1D-myo-inositol Hexakisphosphate Biosynthesis II (mammalian) Pathway Diagram
 Calcium Signaling Pathway antibodies  Calcium Signaling Pathway Diagram
 Calcium Signaling Pathway antibodies  Calcium Signaling Pathway Diagram
 D-myo-inositol (1,3,4)-trisphosphate Biosynthesis Pathway antibodies  D-myo-inositol (1,3,4)-trisphosphate Biosynthesis Pathway Diagram
 D-myo-inositol (1,3,4)-trisphosphate Biosynthesis Pathway antibodies  D-myo-inositol (1,3,4)-trisphosphate Biosynthesis Pathway Diagram
 Inositol Phosphate Metabolism Pathway antibodies  Inositol Phosphate Metabolism Pathway Diagram
 Inositol Phosphate Metabolism Pathway antibodies  Inositol Phosphate Metabolism Pathway Diagram
 Inositol Phosphate Metabolism Pathway antibodies  Inositol Phosphate Metabolism Pathway Diagram
 Inositol Phosphate Metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4 Pathway antibodies  Inositol Phosphate Metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4 Pathway Diagram

Diseases associated with anti-ITPKB antibody

 Disease Name  Pubmed Publications
 Brain Diseases Antibodies  >2 publications with ITPKB and Brain Diseases

Organs/Tissues associated with anti-ITPKB antibody

 Organ/Tissue Name  Pubmed Publications
 Brain Antibodies  >3 publications with ITPKB and Brain
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000