Mouse Anti-MYPN Monoclonal Antibody – Cat# MBS6212681

MYPN Antibody – Mouse Monoclonal

Name: MYPN Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6212681
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6212681

MYPN is a component of the sarcomere that tethers nebulin (MIM 161650) in skeletal muscle and nebulette (MIM 605491) in cardiac muscle to alpha-actinin (see ACTN2; MIM 102573) at the Z lines (Bang et al., 2001 [PubMed 11309420]). [supplied by OMIM] More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

MYPN, Monoclonal Antibody

Full Product Name

MYPN (Myopalladin, 145kD Sarcomeric Protein, MYOP) (MaxLight 550)

Product Gene Name

anti-MYPN antibody

Clonality

Monoclonal

Isotype

IgG1,k

Clone Number

4C8

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human MYPN.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Molecular Weight

145kDa

OMIM

AF328296 mRNA

3D Structure

ModBase 3D Structure for Q86TC9

Immunogen

Partial recombinant corresponding to aa61-171 from human MYPN (NP_115967) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

PDLSAFLSQEELDESVNLARLAINYDPLEKADETQARKRLSPDQMKHSPNLSFEPNFCQDNPRSPTSSKESPQEAKRPQYCSETQSKKVFLNKAADFIEELSSLFKSHSS

Conjugate

MaxLight550

Product Categories/Family for anti-MYPN antibody

Antibodies; Cardiac Markers

Applications Tested/Suitable for anti-MYPN antibody

FLISA, Western Blot (WB)

Application Notes for anti-MYPN antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-MYPN antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for MYPN purchase

MBS6212681 is an antibody targeting MYPN. Also known as MYPN (Myopalladin, 145kD Sarcomeric Protein, MYOP) (MaxLight 550). Reactive in Human. Host: Mouse.

Additional Details

NCBI/Uniprot data below describe general gene information for MYPN. It may not necessarily be applicable to this product.

NCBI GI #

153792294

NCBI GeneID

84665

NCBI Accession #

NP_115967

UniProt Primary Accession #

Q86TC9

UniProt Related Accession #

Q86TC9

GenBank Nucleotide #

NM_032578

NCBI Official Full Name

myopalladin isoform a

NCBI Official Synonym Full Names

myopalladin

NCBI Official Symbol

MYPN

NCBI Official Synonym Symbols

MYOP; RCM4; CMH22; NEM11; CMD1DD

UniProt Protein Name

Myopalladin

UniProt Synonym Protein Names

145 kDa sarcomeric protein

Protein Family

Myopalladin

UniProt Gene Name

MYPN

UniProt Synonym Gene Names

MYOP

NCBI Protein Information

myopalladin

NCBI Summary for MYPN

Striated muscle in vertebrates comprises large proteins which must be organized properly to contract efficiently. Z-lines in striated muscle are a sign of this organization, representing the ends of actin thin filaments, titin, nebulin or nebulette and accessory proteins required for structure and function. This gene encodes a protein which interacts with nebulin in skeletal muscle or nebulette in cardiac muscle and alpha-actinin. In addition, this gene product can interact with a protein with the I-band indicating it has a regulatory as well as structural function. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011]

UniProt Comments for MYPN

Component of the sarcomere that tethers together nebulin (skeletal muscle) and nebulette (cardiac muscle) to alpha-actinin, at the Z lines.

Research Articles on MYPN

1. Targeted sequencing revealed trigenic mutations: c.700G>A/p.E234K in DES, c.2966G>A/p.R989H in MYPN, and c.5918G>C/p.R1973P in CACNA1C in a family of hypertrophic cardiomyopathy with early repolarization and short QT syndrome.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.