Mouse Anti-ANKRD17 Monoclonal Antibody – Cat# MBS6220886

ANKRD17 Antibody – Mouse Monoclonal

Name: ANKRD17 Antibody; Monoclonal; Mouse; Human-Reactive; MyBioSource
Brand: MyBioSource
SKU: MBS6220886
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6220886

MBS6220886 is an antibody targeting ANKRD17. Also known as ANKRD17 (Ankyrin Repeat Domain-containing Protein 17, Gene Trap Ankyrin Repeat Protein, Serologically Defined Breast Cancer Antigen NY-BR-16, GTAR, KIAA0697) (MaxLight 650). Reactive in Human. Host:… More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

ANKRD17, Monoclonal Antibody

Full Product Name

ANKRD17 (Ankyrin Repeat Domain-containing Protein 17, Gene Trap Ankyrin Repeat Protein, Serologically Defined Breast Cancer Antigen NY-BR-16, GTAR, KIAA0697) (MaxLight 650)

Product Gene Name

anti-ANKRD17 antibody

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

2B8

Host

Mouse

Species Reactivity

Human

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.

Purity/Purification

Purified by Protein A Affinity Chromatography.

Specificity

Recognizes human ANKRD17.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

3D Structure

ModBase 3D Structure for O75179

Immunogen

Partial recombinant corresponding to aa2501-2604 from human ANKRD17 (NP_115593) with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG*

Conjugate

MaxLight650

Product Categories/Family for anti-ANKRD17 antibody

Antibodies; Membrane Proteins

Applications Tested/Suitable for anti-ANKRD17 antibody

FLISA, Immunofluorescence (IF), Western Blot (WB)

Application Notes for anti-ANKRD17 antibody

IF: 10ug/ml
Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-ANKRD17 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for ANKRD17. It may not necessarily be applicable to this product.

NCBI GI #

38683807

NCBI Accession #

NP_115593

UniProt Primary Accession #

O75179

GenBank Nucleotide #

NM_032217

NCBI Official Full Name

ankyrin repeat domain-containing protein 17 isoform a

UniProt Protein Name

Ankyrin repeat domain-containing protein 17

UniProt Synonym Protein Names

Gene trap ankyrin repeat protein; Serologically defined breast cancer antigen NY-BR-16

Protein Family

Ankyrin repeat domain-containing protein

UniProt Gene Name

ANKRD17

UniProt Synonym Gene Names

GTAR; KIAA0697

UniProt Entry Name

ANR17_HUMAN

UniProt Comments for ANKRD17

ANKRD17: the earliest specific in situ marker of hepatic differentiation during embryogenesis, useful for characterization of inductive events involved in hepatic specification. Target of enterovirus 71 which is the major etiological agent of HFMD (hand, foot and mouth disease). Interacts with VP1 capsid protein of enterovirus 71 (EV71). Five alternatively processed human isoforms have been described.

Protein type: Cell development/differentiation

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: membrane; cytoplasm; nucleus; chromatin

Molecular Function: protein binding; chromatin binding

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; viral reproduction; defense response to bacterium; positive regulation of cell cycle; innate immune response; negative regulation of smooth muscle cell differentiation; blood vessel maturation; regulation of DNA replication

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Diseases associated with anti-ANKRD17 antibody

Disease Name	Pubmed Publications
Carcinoma Antibodies	>1 publications with ANKRD17 and Carcinoma
Adenocarcinoma Antibodies	>1 publications with ANKRD17 and Adenocarcinoma
Hemorrhage Antibodies	>1 publications with ANKRD17 and Hemorrhage
Intestinal Neoplasms Antibodies	>1 publications with ANKRD17 and Intestinal Neoplasms
Inflammation Antibodies	>1 publications with ANKRD17 and Inflammation
Liver Neoplasms Antibodies	>1 publications with ANKRD17 and Liver Neoplasms
Liver Diseases Antibodies	>1 publications with ANKRD17 and Liver Diseases

Organs/Tissues associated with anti-ANKRD17 antibody

Organ/Tissue Name	Pubmed Publications
Liver Antibodies	>4 publications with ANKRD17 and Liver
Brain Antibodies	>3 publications with ANKRD17 and Brain
Blood Antibodies	>2 publications with ANKRD17 and Blood
Embryonic Tissue Antibodies	>2 publications with ANKRD17 and Embryonic Tissue
Bone Antibodies	>1 publications with ANKRD17 and Bone
Bone Marrow Antibodies	>1 publications with ANKRD17 and Bone Marrow
Vascular Antibodies	>1 publications with ANKRD17 and Vascular
Muscle Antibodies	>1 publications with ANKRD17 and Muscle
Testis Antibodies	>1 publications with ANKRD17 and Testis
Mouth Antibodies	>1 publications with ANKRD17 and Mouth