• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

PACAP (human, sheep, rat) (1-38)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS847934

PACAP (1-38) is an adenylate cyclase activator. More potent than vasoactive intestinal peptide (VIP) . More details

DISCONTINUED
Click here to view our similar product(s) OR click here to contact our technical support team for suitable replacement.
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Product Name
PACAP, Biochemical
Full Product Name
PACAP (human, sheep, rat) (1-38)
Product Synonym Names
Pituitary adenylate cyclase activating polypeptide; HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH
Form/Format
TFA. Lyophilized solid
Purity/Purification
>=95%
Preparation and Storage
Store at -20 degree C
Protect from air and moisture
Shelf life: ~36 months
Molecular Weight
4534.3
Solubility
H?O
Molecular Formula
C???H???N??O??S
CAS Number
124123-15-5
PubChem CID
44566111
SMILES
CCC (C)C (C (=O)NC (CC1=CC=CC=C1)C (=O)NC (C (C)O)C (=O)NC (CC (=O)O)C (=O)NC (CO)C (=O)NC (CC2=CC=C (C=C2)O)C (=O)NC (CO)C (=O)NC (CCCNC (=N)N)C (=O)NC (CC3=CC=C (C=C3)O)C (=O)NC (CCCNC (=N)N)C (=O)NC (CCCCN)C (=O)NC (CCC (=O)N)C (=O)NC (CCSC)C (=O)NC (C)C (=O)NC (C (C)C)C (=O)NC (CCCCN)C (=O)NC (CCCCN)C (=O)NC (CC4=CC=C (C=C4)O)C (=O)NC (CC (C)C)C (=O)NC (C)C (=O)NC (C)C (=O)NC (C (C)C)C (=O)NC (CC (C)C)C (=O)NCC (=O)NC (CCCCN)C (=O)NC (CCCNC (=N)N)C (=O)NC (CC5=CC=C (C=C5)O)C (=O)NC (CCCCN)C (=O)NC (CCC (=O)N)C (=O)NC (CCCNC (=N)N)C (=O)NC (C (C)C)C (=O)NC (CCCCN)C (=O)NC (CC (=O)N)C (=O)NC (CCCCN)C (=O)N)NC (=O)CNC (=O)C (CC (=O)O)NC (=O)C (CO)NC (=O)C (CC6=CN=CN6)N
InChi
InChI=1S/C203H331N63O53S/c1-18-109 (12)162 (262-156 (279)99-230-170 (290)147 (95-157 (280)281)255-193 (313)149 (100-267)259-168 (288)124 (211)93-119-97-224-103-231-119)198 (318)257-145 (88-114-40-20-19-21-41-114)191 (311)266-163 (113 (16)270)199 (319)258-148 (96-158 (282)283)190 (310)261-151 (102-269)194 (314)253-144 (92-118-59-67-123 (274)68-60-118)188 (308)260-150 (101-268)192 (312)243-134 (51-38-83-227-202 (220)221)180 (300)251-142 (90-116-55-63-121 (272)64-56-116)186 (306)242-132 (49-36-81-225-200 (216)217)176 (296)237-127 (44-24-31-76-206)173 (293)245-137 (70-72-153 (213)276)182 (302)246-138 (73-85-320-17)171 (291)233-112 (15)167 (287)263-159 (106 (6)7)195 (315)247-130 (47-27-34-79-209)175 (295)238-129 (46-26-33-78-208)177 (297)252-143 (91-117-57-65-122 (273)66-58-117)187 (307)249-140 (87-105 (4)5)184 (304)234-110 (13)165 (285)232-111 (14)166 (286)264-160 (107 (8)9)197 (317)256-139 (86-104 (2)3)169 (289)229-98-155 (278)235-126 (43-23-30-75-205)172 (292)239-133 (50-37-82-226-201 (218)219)179 (299)250-141 (89-115-53-61-120 (271)62-54-115)185 (305)241-128 (45-25-32-77-207)174 (294)244-136 (69-71-152 (212)275)181 (301)240-135 (52-39-84-228-203 (222)223)183 (303)265-161 (108 (10)11)196 (316)248-131 (48-28-35-80-210)178 (298)254-146 (94-154 (214)277)189 (309)236-125 (164 (215)284)42-22-29-74-204/h19-21,40-41,53-68,97,103-113,124-151,159-163,267-274H,18,22-39,42-52,69-96,98-102,204-211H2,1-17H3, (H2,212,275)(H2,213,276)(H2,214,277)(H2,215,284)(H,224,231)(H,229,289)(H,230,290)(H,232,285)(H,233,291)(H,234,304)(H,235,278)(H,236,309)(H,237,296)(H,238,295)(H,239,292)(H,240,301)(H,241,305)(H,242,306)(H,243,312)(H,244,294)(H,245,293)(H,246,302)(H,247,315)(H,248,316)(H,249,307)(H,250,299)(H,251,300)(H,252,297)(H,253,314)(H,254,298)(H,255,313)(H,256,317)(H,257,318)(H,258,319)(H,259,288)(H,260,308)(H,261,310)(H,262,279)(H,263,287)(H,264,286)(H,265,303)(H,266,311)(H,280,281)(H,282,283)(H4,216,217,225)(H4,218,219,226)
InChi Key
UFTCZKMBJOPXDM-XXFCQBPRSA-N

Product Categories/Family for PACAP biochemical

Biochemicals; Activators; Inducers; Agonists; Adenylase Cyclase Activators; Biochemicals (A-Z)

Product References and Citations for PACAP biochemical

https://pubchem.ncbi.nlm.nih.gov/compound/44566111

Other Notes

Small volumes of PACAP biochemical vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Searchable Terms for PACAP purchase

MBS847934 is a biochemical targeting PACAP. Also known as PACAP (human, sheep, rat) (1-38).

Additional Details

NCBI/Uniprot data below describe general gene information for PACAP. It may not necessarily be applicable to this product.

Protein Family
Pituitary adenylate cyclase-activating polypeptide type I receptor

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000