• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

BTBD9 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6168424

MBS6168424 is an antibody targeting BTBD9. Also known as BTBD9 (BTB (POZ) Domain Containing 9, FLJ32945, KIAA1880, MGC120517, MGC120519, MGC120520, dJ322I12.1) (APC). Host: Mouse. Mouse monoclonal antibody raised against a partial recombinant BTBD9. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
BTBD9, Monoclonal Antibody
Full Product Name
BTBD9 (BTB (POZ) Domain Containing 9, FLJ32945, KIAA1880, MGC120517, MGC120519, MGC120520, dJ322I12.1) (APC)
Product Gene Name
anti-BTBD9 antibody
Product Synonym Names
BTB (POZ) Domain Containing 9; FLJ32945; KIAA1880; MGC120517; MGC120519; MGC120520; dJ322I12.1
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G3
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Purity/Purification
Purified
Specificity
Recognizes BTBD9.
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
OMIM
611185
3D Structure
ModBase 3D Structure for Q96Q07
Immunogen
BTBD9 (NP_689946, 2aa-70aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RESQPEAEIPLQDTTAEAFTMLLKYIYTGRATLTDEKEEVLLDFLSLAHKYGFPELEDSTSEYLCTILN
Conjugate
APC

Product Categories/Family for anti-BTBD9 antibody

Antibodies; Proteins
Applications Tested/Suitable for anti-BTBD9 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes for anti-BTBD9 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-BTBD9 antibody

Western Blot analysis of BTBD9 expression in transfected 293T cell line by BTBD9 monoclonal antibody (M02), clone 1G3.

Lane 1: BTBD9 transfected lysate(65.7 KDa).
Lane 2: Non-transfected lysate.
Mouse Anti-BTBD9 Monoclonal Antibody – Cat# MBS6168424

Immunofluorescence (IF) of anti-BTBD9 antibody

Immunofluorescence of monoclonal antibody to BTBD9 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-BTBD9 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6168424

Immunofluorescence (IF) of anti-BTBD9 antibody

Immunofluorescence of monoclonal antibody to BTBD9 on HeLa cell. [antibody concentration 10 ug/ml]
Mouse Anti-BTBD9 Monoclonal Antibody, Immunofluorescence (IF) – Cat# MBS6168424

Other Notes

Small volumes of anti-BTBD9 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for BTBD9. It may not necessarily be applicable to this product.

NCBI GI #
151108435
NCBI GeneID
114781
NCBI Accession #
NP_689946
UniProt Primary Accession #
Q96Q07
UniProt Related Accession #
Q96Q07
GenBank Nucleotide #
NP_689946.2
NCBI Official Full Name
BTB/POZ domain-containing protein 9 isoform b
NCBI Official Synonym Full Names
BTB domain containing 9
NCBI Official Symbol
BTBD9
NCBI Official Synonym Symbols
dJ322I12.1
UniProt Protein Name
BTB/POZ domain-containing protein 9
Protein Family
BTB/POZ domain-containing protein
UniProt Gene Name
BTBD9
UniProt Synonym Gene Names
KIAA1880
UniProt Entry Name
BTBD9_HUMAN
NCBI Protein Information
BTB/POZ domain-containing protein 9

NCBI Summary for BTBD9

This locus encodes a BTB/POZ domain-containing protein. This domain is known to be involved in protein-protein interactions. Polymorphisms at this locus have been reported to be associated with susceptibility to Restless Legs Syndrome and may also be associated with Tourette Syndrome. Alternatively spliced transcript variants have been described. [provided by RefSeq, Aug 2011]
Show more

UniProt Comments for BTBD9

BTBD9: Genetic variations in BTBD9 may be associated with susceptibility to restless legs syndrome type 6 (RLS6); also called periodic limb movements in sleep. Restless legs syndrome (RLS) is a neurologic disorder characterized by an uncontrollable urge to move the legs during periods of rest. The majority of patients with RLS also have periodic limb movements in sleep, which are characterized by involuntary, highly stereotypical, regularly occurring limb movements that occur during sleep. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 6p21

Biological Process: circadian sleep/wake cycle, non-REM sleep; long-term memory; adult locomotory behavior; sensory perception of temperature stimulus; serotonin metabolic process

Disease: Restless Legs Syndrome, Susceptibility To, 6
Show more

Research Articles on BTBD9

1. results confirmed the association of BTBD9 and MAP2K5/SKOR1 with primary Restless Legs Syndrome in Chinese population

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000