Mouse Anti-CCL14 Monoclonal Antibody – Cat# MBS6167736

CCL14 Antibody – Mouse Monoclonal

Name: CCL14 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6167736
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6167736

MBS6167736 is an antibody targeting CCL14. Also known as CCL14 (Chemokine (C-C Motif) Ligand 14, CC-1, CC-3, CKb1, HCC-1, HCC-3, MCIF, NCC-2, NCC2, SCYA14, SCYL2, SY14) (APC). Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

CCL14, Monoclonal Antibody

Full Product Name

CCL14 (Chemokine (C-C Motif) Ligand 14, CC-1, CC-3, CKb1, HCC-1, HCC-3, MCIF, NCC-2, NCC2, SCYA14, SCYL2, SY14) (APC)

Product Gene Name

anti-CCL14 antibody

Product Synonym Names

Chemokine (C-C Motif) Ligand 14; CC-1; CC-3; CKb1; HCC-1; HCC-3; MCIF; NCC-2; NCC2; SCYA14; SCYL2; SY14

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

3B12

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

Purity/Purification

Purified

Specificity

Recognizes CCL14.

Preparation and Storage

Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunogen

CCL14 (AAH45165, 20aa-93aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Conjugate

APC

Product Categories/Family for anti-CCL14 antibody

Antibodies; Growth Factors; Cytokines

Applications Tested/Suitable for anti-CCL14 antibody

ELISA (EIA)

Application Notes for anti-CCL14 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-CCL14 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for CCL14. It may not necessarily be applicable to this product.

NCBI GI #

28175708

NCBI GeneID

6358

NCBI Accession #

AAH45165

UniProt Related Accession #

Q16627

NCBI Official Full Name

Chemokine (C-C motif) ligand 14

NCBI Official Synonym Full Names

C-C motif chemokine ligand 14

NCBI Official Symbol

CCL14

NCBI Official Synonym Symbols

CC-1; CC-3; CKB1; MCIF; NCC2; SY14; HCC-1; HCC-3; NCC-2; SCYL2; SCYA14; HCC-1(1-74); HCC-1/HCC-3

Protein Family

C-C motif chemokine

NCBI Protein Information

C-C motif chemokine 14

NCBI Summary for CCL14

This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. [provided by RefSeq, Dec 2009]

Research Articles on CCL14

1. CCL14 expression in healthy human palatal mucosa is strongly negatively correlated with serum cotinine levels.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.