• Call +1.858.633.0165 or Fax +1.858.633.0166 or Contact Us

DAZAP2 Antibody – Mouse Monoclonal

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6183370

MBS6183370 is an antibody targeting DAZAP2. Also known as DAZAP2 (DAZ Associated Protein 2, KIAA0058, MGC14319, MGC766, PRTB) (HRP). Host: Mouse. More details

$1140 / 0.1 mL +1 FREE 8GB USB
Product Documentation
PDF
Sample Manual Insert View PDF
PDF
Testing Data View PDF
PDF
Certificate of Analysis (COA) View PDF
PDF
QC Report View PDF
PDF
Material Safety Data Sheet View PDF
PDF
Technical Datasheet View PDF
PDF
Protocol View PDF

Product Overview

Online Datasheet in PDF
Product Name
DAZAP2, Monoclonal Antibody
Full Product Name
DAZAP2 (DAZ Associated Protein 2, KIAA0058, MGC14319, MGC766, PRTB) (HRP)
Product Gene Name
anti-DAZAP2 antibody
Product Synonym Names
DAZ Associated Protein 2; KIAA0058; MGC14319; MGC766; PRTB
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8G5
Host
Mouse
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity/Purification
Purified
Specificity
Recognizes DAZAP2.
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
OMIM
607431
3D Structure
ModBase 3D Structure for Q15038
Immunogen
DAZAP2 (NP_055579.1, 1aa-168aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
Conjugate
HRP

Product Categories/Family for anti-DAZAP2 antibody

Antibodies; KIAA; orf
Applications Tested/Suitable for anti-DAZAP2 antibody
Western Blot (WB)
Application Notes for anti-DAZAP2 antibody
Applications are based on unconjugated antibody.

Western Blot (WB) of anti-DAZAP2 antibody

Western Blot analysis of DAZAP2 expression in transfected 293T cell line by DAZAP2 monoclonal antibody (M06), clone 8G5.

Lane 1: DAZAP2 transfected lysate (Predicted MW: 17.3 KDa).
Lane 2: Non-transfected lysate.
Mouse Anti-DAZAP2 Monoclonal Antibody – Cat# MBS6183370

Western Blot (WB) of anti-DAZAP2 antibody

DAZAP2 monoclonal antibody (M06), clone 8G5. Western Blot analysis of DAZAP2 expression in HeLa.
Mouse Anti-DAZAP2 Monoclonal Antibody, Western Blot (WB) – Cat# MBS6183370

Testing Data of anti-DAZAP2 antibody

Detection limit for recombinant GST tagged DAZAP2 is 0.03 ng/ml as a capture antibody.
Mouse Anti-DAZAP2 Monoclonal Antibody, Testing Data – Cat# MBS6183370

Other Notes

Small volumes of anti-DAZAP2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for DAZAP2. It may not necessarily be applicable to this product.

NCBI GI #
7661886
NCBI GeneID
9802
NCBI Accession #
NP_055579.1
UniProt Primary Accession #
Q15038
UniProt Related Accession #
Q15038
GenBank Nucleotide #
NP_055579.1
NCBI Official Full Name
DAZ-associated protein 2 isoform a
NCBI Official Synonym Full Names
DAZ associated protein 2
NCBI Official Symbol
DAZAP2
NCBI Official Synonym Symbols
PRTB
UniProt Protein Name
DAZ-associated protein 2
UniProt Synonym Protein Names
Deleted in azoospermia-associated protein 2
Protein Family
DAZ-associated protein
UniProt Gene Name
DAZAP2
UniProt Synonym Gene Names
KIAA0058
UniProt Entry Name
DAZP2_HUMAN
NCBI Protein Information
DAZ-associated protein 2

NCBI Summary for DAZAP2

This gene encodes a proline-rich protein which interacts with the deleted in azoospermia (DAZ) and the deleted in azoospermia-like gene through the DAZ-like repeats. This protein also interacts with the transforming growth factor-beta signaling molecule SARA (Smad anchor for receptor activation), eukaryotic initiation factor 4G, and an E3 ubiquitinase that regulates its stability in splicing factor containing nuclear speckles. The encoded protein may function in various biological and pathological processes including spermatogenesis, cell signaling and transcription regulation, formation of stress granules during translation arrest, RNA splicing, and pathogenesis of multiple myeloma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]
Show more

UniProt Comments for DAZAP2

DAZAP2: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 12q12

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; WW domain binding

Research Articles on DAZAP2

1. methylation of DAZAP2 promoter was involved in downregulation of DAZAP2 in multiple myeloma cells.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.
Request a Quote

Please fill out the form below and our representative will get back to you shortly.

MBS000000
Contact Us

Please fill out the form below and our representative will get back to you shortly.

MBS000000