Mouse Anti-EIF4E2 Monoclonal Antibody – Cat# MBS6172921

EIF4E2 monoclonal antibody (M02), clone 1A11 Western Blot analysis of EIF4E2 expression in MCF-7 (Cat # L046V1).

EIF4E2 Antibody – Mouse Monoclonal

Name: EIF4E2 Antibody; Monoclonal; Mouse; MyBioSource
Brand: MyBioSource
SKU: MBS6172921
Price: 1140 USD
Availability: InStock
Rating: 5 (10 reviews)

For Research Use Only. Not for use in diagnostic procedures. Catalog #: MBS6172921

MBS6172921 is an antibody targeting EIF4E2. Also known as EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2, 4E-LP, 4EHP, EIF4EL3, IF4e) (Biotin). Host: Mouse. Mouse monoclonal antibody raised against a partial recombinant EIF4E2. More details

$1140 / 0.1 mL +1 FREE 8GB USB

Product Documentation

Sample Manual Insert View PDF

Testing Data View PDF

Certificate of Analysis (COA) View PDF

QC Report View PDF

Material Safety Data Sheet View PDF

Technical Datasheet View PDF

Protocol View PDF

Product Overview

Online Datasheet in PDF

Product Name

EIF4E2, Monoclonal Antibody

Full Product Name

EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2, 4E-LP, 4EHP, EIF4EL3, IF4e) (Biotin)

Product Gene Name

anti-EIF4E2 antibody

Product Synonym Names

Eukaryotic Translation Initiation Factor 4E Family Member 2; 4E-LP; 4EHP; EIF4EL3; IF4e

Clonality

Monoclonal

Isotype

IgG2a,k

Clone Number

1A11

Host

Mouse

Form/Format

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

Purity/Purification

Purified

Specificity

Recognizes EIF4E2.

Preparation and Storage

Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Molecular Weight

27,026 Da

OMIM

605895

3D Structure

ModBase 3D Structure for O60573

Immunogen

EIF4E2 (NP_004837, 146aa-245aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Immunogen Sequence

RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP

Conjugate

Biotin

Product Categories/Family for anti-EIF4E2 antibody

Antibodies; Translation Initiation Factors

Applications Tested/Suitable for anti-EIF4E2 antibody

ELISA (EIA), Western Blot (WB)

Application Notes for anti-EIF4E2 antibody

Applications are based on unconjugated antibody.

Other Notes

Small volumes of anti-EIF4E2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.

Additional Details

NCBI/Uniprot data below describe general gene information for EIF4E2. It may not necessarily be applicable to this product.

NCBI GI #

4757702

NCBI GeneID

9470

NCBI Accession #

NP_004837

UniProt Primary Accession #

O60573

UniProt Secondary Accession #

O75349; B8ZZJ9

UniProt Related Accession #

O60573

GenBank Nucleotide #

NM_004846.2

NCBI Official Full Name

eukaryotic translation initiation factor 4E type 2 isoform A

NCBI Official Synonym Full Names

eukaryotic translation initiation factor 4E family member 2

NCBI Official Symbol

EIF4E2

NCBI Official Synonym Symbols

4EHP; IF4e; 4E-LP; EIF4EL3

UniProt Protein Name

Eukaryotic translation initiation factor 4E type 2

UniProt Synonym Protein Names

Eukaryotic translation initiation factor 4E homologous protein; Eukaryotic translation initiation factor 4E-like 3; eIF4E-like protein 4E-LP; mRNA cap-binding protein 4EHP; mRNA cap-binding protein type 3

Protein Family

Eukaryotic translation initiation factor

UniProt Gene Name

EIF4E2

UniProt Synonym Gene Names

EIF4EL3; eIF-4E type 2; eIF4E type 2

UniProt Entry Name

IF4E2_HUMAN

NCBI Protein Information

eukaryotic translation initiation factor 4E type 2

UniProt Comments for EIF4E2

EIF4E2: Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures. eIF4F is a multi-subunit complex, the composition of which varies with external and internal environmental conditions. It is composed of at least eIF4A, eIF4E and eIF4G. eIF4E is also known to interact with other partners. EIF4E2 interacts with EIF4EBP1, EIF4EBP2 and EIF4EBP3 but not with eIF4G. Belongs to the eukaryotic initiation factor 4E family.

Protein type: Translation initiation; Translation

Chromosomal Location of Human Ortholog: 2q37.1

Cellular Component: mRNA cap complex; cytosol

Molecular Function: protein binding; translation factor activity, nucleic acid binding; translation initiation factor activity; ubiquitin protein ligase binding; RNA cap binding

Biological Process: in utero embryonic development; cytokine and chemokine mediated signaling pathway; negative regulation of translation; translational initiation

Research Articles on EIF4E2

1. DNA damage induces an increase in ARIH1 protein levels and association of ARIH1 with 4EHP. In turn, this causes 4EHP recruitment to the mRNA cap, where it is known to compete with eIF4E.

Precautions

All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.

Disclaimer

While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.

It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.

Product Note

Select online data sheet information is drawn from bioinformatics databases, occasionally resulting in ambiguous or non-relevant product information. It is the responsibility of the customer to review, verify, and evaluate the information to make sure it matches their requirements before purchasing the kit. Our ELISA Kit assays are dynamic research tools and sometimes they may be updated and improved. If the format of this assay is important to you then please request the current manual or contact our technical support team with a presales inquiry before placing an order. We will confirm the current details of the assay. We cannot guarantee the sample manual posted online is the most current manual, it is intended to serve as an example only. Please refer to the instructions For Use provided with the assay kit for precise details.

Product PubMed Publications

Products associated with anti-EIF4E2 antibody

Reference Product	PubMed Publications
ISG15 antibody	>2 publications with EIF4E2 and ISG15
EIF4E3 antibody	>2 publications with EIF4E2 and EIF4E3
EIF4EBP1 antibody	>2 publications with EIF4E2 and EIF4EBP1

Pathways associated with anti-EIF4E2 antibody

Products by Pathway	Pathway Diagram
Antiviral Mechanism By IFN-stimulated Genes Pathway antibodies	Antiviral Mechanism By IFN-stimulated Genes Pathway Diagram
Cytokine Signaling In Immune System Pathway antibodies	Cytokine Signaling In Immune System Pathway Diagram
HIF-1 Signaling Pathway antibodies	HIF-1 Signaling Pathway Diagram
ISG15 Antiviral Mechanism Pathway antibodies	ISG15 Antiviral Mechanism Pathway Diagram
Immune System Pathway antibodies	Immune System Pathway Diagram
Insulin Signaling Pathway antibodies	Insulin Signaling Pathway Diagram
Insulin Signaling Pathway antibodies	Insulin Signaling Pathway Diagram
Interferon Signaling Pathway antibodies	Interferon Signaling Pathway Diagram
PI3K-Akt Signaling Pathway antibodies	PI3K-Akt Signaling Pathway Diagram
PI3K-Akt Signaling Pathway antibodies	PI3K-Akt Signaling Pathway Diagram

Organs/Tissues associated with anti-EIF4E2 antibody

Organ/Tissue Name	Pubmed Publications
Blood Antibodies	>1 publications with EIF4E2 and Blood
Pancreas Antibodies	>1 publications with EIF4E2 and Pancreas
Lung Antibodies	>1 publications with EIF4E2 and Lung
Brain Antibodies	>1 publications with EIF4E2 and Brain